SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2J8RYK0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8RYK0
Domain Number 1 Region: 5-186
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.6e-51
Family Calponin-homology domain, CH-domain 0.00000334
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2J8RYK0
Sequence length 297
Comment (tr|A0A2J8RYK0|A0A2J8RYK0_PONAB) CNN1 isoform 2 {ECO:0000313|EMBL:PNJ13615.1} OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0047951 OC=Catarrhini; Hominidae; Pongo.
Sequence
MSSAHFNRGPAYGLSAEVKNKLAQKYDHQREQELREWIEGVTGRRIGNNFMDGLKDGIIL
CEFINKLQPGSVKKINESTQNWHQLENIGNFIKAITKYGVKPHDIFEANDLFENTNHTQV
QSTLLALASMAKTKGNKVNVGVKYAEKQERKFEPGKLREGRNIIGLQMGTNKFASQQGMT
AYGTRRHLYDPKLGTDQPLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDT
LNVSLQMGSNKGASQRGMTVYGLPRQVYDPKYCLTPEYPELGEPAHNHHAHNYYNSA
Download sequence
Identical sequences A0A2J8RYK0 G3S3B2 H2QFE4 P51911 V9HWA5
NP_001290.2.87134 NP_001290.2.92137 gi|21361120|ref|NP_001290.2| ENSPTRP00000017928 ENSPTRP00000017928 ENSGGOP00000022562 ENSGGOP00000022562 9598.ENSPTRP00000017928 9606.ENSP00000252456 ENSP00000252456 ENSP00000252456 ENSP00000252456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]