SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2J8SNR5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2J8SNR5
Domain Number - Region: 27-75
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0107
Family DBL homology domain (DH-domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2J8SNR5
Sequence length 86
Comment (tr|A0A2J8SNR5|A0A2J8SNR5_PONAB) ABR isoform 32 {ECO:0000313|EMBL:PNJ22400.1} OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0041383 OC=Catarrhini; Hominidae; Pongo.
Sequence
MPYIDESPTMSPQLSARSQGGGDGVSPTPPEGLAPGVEAGKGLEMRKLVLSGFLASEEIY
INQLEALLLPMKPLKATATTSQPVLT
Download sequence
Identical sequences A0A2J8JKK1 A0A2J8SNR5 I3L259
ENSP00000459406 ENSP00000459406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]