SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2J8SR06 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8SR06
Domain Number 1 Region: 496-751
Classification Level Classification E-value
Superfamily YWTD domain 9.55e-57
Family YWTD domain 0.00000308
Further Details:      
 
Domain Number 2 Region: 195-441
Classification Level Classification E-value
Superfamily YWTD domain 1.01e-49
Family YWTD domain 0.00000336
Further Details:      
 
Domain Number 3 Region: 799-1058
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-39
Family YWTD domain 0.0000389
Further Details:      
 
Domain Number 4 Region: 2-144
Classification Level Classification E-value
Superfamily YWTD domain 4.58e-33
Family YWTD domain 0.0000194
Further Details:      
 
Domain Number 5 Region: 753-800
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000838
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1189-1227
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000602
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 7 Region: 451-498
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000105
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 8 Region: 1110-1150
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000117
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 1151-1187
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 10 Region: 147-189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000709
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 11 Region: 1068-1121
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000706
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2J8SR06
Sequence length 1477
Comment (tr|A0A2J8SR06|A0A2J8SR06_PONAB) LRP6 isoform 5 {ECO:0000313|EMBL:PNJ23207.1} OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0041118 OC=Catarrhini; Hominidae; Pongo.
Sequence
LDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFIIINSEIYWPNGLTLDYEEQKL
YWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDILYWTDWSTHSILACNKYTGE
GLREIHSNIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMSPVKPFYQCACPTGVKL
LENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIRHAIAIDYDPVEGYIYW
TDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTM
RKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRVVLVNTSLGWPNGLA
LDYDEGKIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTLLGDYVYWTDWQRRSIE
RVHKRSAEREVIIDQLPDLMGLKATNVHRVIGSNPCAEENGGCSHLCLYRPQGLRCACPI
GFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRI
YWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDG
QHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRANGL
TIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQYQDYIYWTDWSRRSIE
RANKTSGQNRTIIQGHLDYVMDILVFHSSRQSGWNECASSNGHCSHLCLAVPVGGFVCGC
PAHYSLNADNRTCSAPTTFLLFSQKSAVNRMVIDEQQSPDIILPIHSLRNVRAIDYDPLD
KQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPSQNLEIQPYDLSIDIYSRYIYWTCEATN
VINVTRLDGRSVGVVLKGEQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTEREVL
FFSGLSKPIALALDSRLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENW
LYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQEYRQHPCAQDNGGCSH
ICLVKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGFTEC
EDHSDELNCPVCSESQFQCASGQCIDGAFRCNGDANCQDKSDEKNCEVLCLIDQFRCANG
QCIGKHKKCDHNVDCSDKSDELDCYPTEEPAPQATNTVGSVIGVIVTIFVSGTIYFICQR
MLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSMISSLSIMGGSS
GPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTMEFGYSSNSPSTHRSYS
YRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVATAKGYTSDLNYDSEPVPPPPTPRSQ
YLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences A0A2J8SR06

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]