SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8T2D9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8T2D9
Domain Number 1 Region: 3-246
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.1e-134
Family Capz beta-1 subunit 0.000000000433
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2J8T2D9
Sequence length 272
Comment (tr|A0A2J8T2D9|A0A2J8T2D9_PONAB) CAPZB isoform 5 {ECO:0000313|EMBL:PNJ27188.1} OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0038225 OC=Catarrhini; Hominidae; Pongo.
Sequence
MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYL
LCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVY
LWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTN
KSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIV
NGLRSVQTFADKSKQEALKNDLVEALKRKQQC
Download sequence
Identical sequences A0A1S3GLX3 A0A1U7R4Y2 A0A2J8T2D9 A9XFX6 F7H3P1 K7AHH7 M3YXJ4 Q5R507 Q5XI32 Q923G3
NP_001005903.1.100692 NP_001005903.1.4139 NP_001106915.1.46622 NP_001127638.1.23681 NP_004921.1.87134 NP_004921.1.92137 NP_033928.1.92730 XP_002750414.1.60252 XP_003307887.1.37143 XP_004024835.1.27298 XP_004272525.1.21590 XP_004678616.1.23501 XP_005081113.1.91757 XP_005353006.1.66349 XP_006866383.1.41390 XP_007104650.1.24612 XP_008820057.1.79516 XP_008998787.1.60252 XP_010591354.1.64505 XP_012024662.1.54773 XP_012416699.1.74151 XP_012889695.1.60039 XP_015983746.1.101085 XP_017361556.1.71028 XP_019317125.1.44245 XP_019774412.1.83887 XP_020020975.1.5219 XP_021539763.1.83697 ENSP00000264202 ENSCJAP00000048157 ENSMPUP00000016054 ENSCJAP00000012512 ENSMUSP00000099566 ENSRNOP00000010308 6f1t_L 6f38_L 6f3a_L ENSSSCP00000003792 Hs4826659___KOG3174 ENSP00000383862 ENSMPUP00000016054 gi|4826659|ref|NP_004921.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]