SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2J8UH82 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8UH82
Domain Number 1 Region: 20-177
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.86e-65
Family GABA-aminotransferase-like 0.0000000557
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2J8UH82
Sequence length 192
Comment (tr|A0A2J8UH82|A0A2J8UH82_PONAB) SHMT2 isoform 6 {ECO:0000313|EMBL:PNJ44641.1} OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0027770 OC=Catarrhini; Hominidae; Pongo.
Sequence
MAIRAQHSNAAQTQTGEANRGWTGQESLSDSDPEMWELLQREKDRQCRGLELIASENFCS
RAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQRRALEAFDLDPAQWGVNVQPY
SGSPANLAVYTALLQPHDRIMGLDLPDGGHLTHGYMSDVKRISATSIFFESMPYKLNGFS
CLCVCPAQNWPH
Download sequence
Identical sequences A0A2J8UH82 G3V540
ENSP00000451371 ENSP00000452163 ENSP00000451371 ENSP00000452163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]