SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2J9U134 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J9U134
Domain Number 1 Region: 453-562
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000149
Family Anti-sigma factor antagonist SpoIIaa 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2J9U134
Sequence length 575
Comment (tr|A0A2J9U134|A0A2J9U134_BORPP) SulP family inorganic anion transporter {ECO:0000313|EMBL:PNM45250.1} OX=519 OS=Bordetella parapertussis. GN=AL462_008060 OC=Alcaligenaceae; Bordetella.
Sequence
MASSPADTPHRNWLRWLPGLAVLKTYQAAWLPRDLAAGLVLTAMLVPVGIAYAEASGVPG
VYGLYATIVPLLAYALFGPSRILVLGPDSALAAPILAVVLSVSEGDPMRAVATASLMAIV
SGLFCIILGLLRLGFITELLSKPIRYGYMNGIALVVLASQLPKLFAIPTDDGGPLRELWQ
LAQAVLDGRTNGYSLAVGSAALGLILLLKRFKRLPGILIAVVLATLAVSLFGLDGRGVQV
LGEIPQGLPGFTIPWLSNADLARIVLGGCAIALISFADTSVLSRTYAARTHTRVDPNQEM
VGLGVANLATGFFQGFPVSSSASRTPVAEAAGSRTQLAGVVGALAVAALLLAAPNLLRHL
PSSAMAAVVIAAAIGLFEFKDLRRIFRIQQWEFWLSMLCFAAVVAFGAIPGICLAVVVAV
LEFLWDGWRPHFAVLGRVPDLRGYHDLKRYPHAALIDGLVLFRWDAPLFFANAELFQQRL
LEAVQASPTPVQRVVVTAEPVTSVDVTSADMLRELSHHLAESGIALHFAEMKDPVRDKLK
RFELSEVFGADRFHPTVESAVDDYLKRPPQGTIDP
Download sequence
Identical sequences A0A2J9U134 Q7WAU2
gi|33595942|ref|NP_883585.1| GO.9074 WP_010927946.1.23657 WP_010927946.1.26498 257311.BPP1275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]