SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2K2TGU5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K2TGU5
Domain Number 1 Region: 33-275
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.8e-70
Family Phosphate binding protein-like 0.00000546
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K2TGU5
Sequence length 282
Comment (tr|A0A2K2TGU5|A0A2K2TGU5_LACFE) Metal ABC transporter substrate-binding protein {ECO:0000313|EMBL:PNV57345.1} OX=1613 OS=Lactobacillus fermentum. GN=C1Y38_08540 OC=Lactobacillus.
Sequence
MRKYRWWLVAILIIILAAFGLHLATSSKVSQHTVTVGSIGPDVQVWQHIAKSKAAKKAGI
KINVKSFTDPIGLNKATASGEIDVNAFQSWSYLETYNKQNKKAQLAALGTTYLEPMGIYS
KRYKKVSDLPNGATIAIANNPANTARGLLLLQSAGLITLKKGFGVTSGTNEIASNPRHFK
FEEIDDTTGPRVLNSVDAVLIGNTIALTGHLNVLTDSIYHEKIDQTTKNNINILATAKKN
AHNQTYLKLVKLYHNQQIQEWIKKKYQGTKVEVNKPLSYLEK
Download sequence
Identical sequences A0A2K2TGU5 D8IGK9
gi|385811893|ref|YP_005848284.1| WP_014562123.1.82607 WP_014562123.1.86783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]