SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K2ZUN0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K2ZUN0
Domain Number 1 Region: 9-45
Classification Level Classification E-value
Superfamily Photosystem II reaction center protein K, PsbK 3.79e-17
Family PsbK-like 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K2ZUN0
Sequence length 45
Comment (tr|A0A2K2ZUN0|A0A2K2ZUN0_HALP7) Photosystem II reaction center protein K {ECO:0000313|EMBL:PNW35267.1} OX=65093 OS=Halothece sp. (strain PCC 7418) (Synechococcus sp. (strain PCC 7418)). GN=BEN50_17805 OC=Aphanothecaceae; Halothece cluster; Halothece.
Sequence
MEATFLFAKLPEAYSIFDPLVDVLPLIPVFFLLLAFVWQAAVGFK
Download sequence
Identical sequences A0A2K2ZUN0 K9YXH8
WP_015230177.1.8022 gi|428780758|ref|YP_007172544.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]