SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2K3DE08 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2K3DE08
Domain Number - Region: 92-121
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000497
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K3DE08
Sequence length 397
Comment (tr|A0A2K3DE08|A0A2K3DE08_CHLRE) Uncharacterized protein {ECO:0000313|EMBL:PNW78772.1} OX=3055 OS=Chlamydomonas reinhardtii (Chlamydomonas smithii). GN=CHLRE_09g389652v5 OC=Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas.
Sequence
MATRGIAQLKAQYNRVRTSTALQGNSMWNNVIGIENEQKGTNSAIEAALHAPSYGGGHKA
QRMERAQALIEQAGYQPKATDLQGLLALAKSQGATGNATRGACKICGGLGHLTKKCKNGV
SGHTGDIGDLDAAAAVASMRALLPDPDEVSSLGSSDLDGSDLSDSDGDGGEKRKRKHSSS
KKEKKEKDKKRKKEKSSKKGKKERKEKKDKREKRDKKRRHEEDDREGSGKRARDESDSSS
DSGSDSDGDRRREKRRRSSRERDSKEREQRGGREEDAREERRGEGHEDRRGEGHEDRRGE
GREERRGEAREPEREREREHEREREREHGRGGGRDEGEREYDREAWRRMERQRGEREGGA
GGRNRDRDREERERGKEREQGRERDRSHERDGSRERR
Download sequence
Identical sequences A0A2K3DE08
3055.JGI206486 jgi|Chlre4|206486|OVA_OVA_fgenesh2_pg.C_scaffold_24000229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]