SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2K3J104 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K3J104
Domain Number 1 Region: 1205-1424
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.57e-32
Family Glycosyl hydrolases family 16 0.067
Further Details:      
 
Domain Number 2 Region: 426-559
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.09e-19
Family Bacterial dinuclear zinc exopeptidases 0.048
Further Details:      
 
Domain Number 3 Region: 853-984
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000000458
Family PKD domain 0.0017
Further Details:      
 
Domain Number 4 Region: 990-1069
Classification Level Classification E-value
Superfamily PKD domain 0.00000000000109
Family PKD domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K3J104
Sequence length 2100
Comment (tr|A0A2K3J104|A0A2K3J104_9EURY) Uncharacterized protein {ECO:0000313|EMBL:PNX47717.1} OX=1933281 OS=Thermoplasmata archaeon M11B2D. GN=BV459_03860 OC=Archaea; Euryarchaeota; Thermoplasmata; unclassified Thermoplasmata.
Sequence
MLLISSTTSMVLFSDTVKVEASGGGQQGVGCVNLDYDWVWFQVQEFANVIRKVNWSQNGG
NGIPKGRAWATAGENYTRDTILWPNMGITDNPCGLTGYTNLTIGYINSSAGYIPPLRLRP
KQYSSKIIIKDYGLTISENGDLYKELSYSEMFPIGIGMIPWKEGGALNESWLTNTFGFTD
AEVRIRSLWNGGLIQDFREVSCEFLNTYNELDGQAVFLNTTDPLPENHDVVFILKEEPAS
EEKIQNLSDSEGIILIENSTKTYTFQNSSLFNCSIARLNGTDSNFIKVLSEIKNGSNYTV
DNFLHSEILIFSNYSNASCCPGPDYVIIVQLSKEGDYSKVMRRAKKWSLDGHCKGIIMSG
VNDSTHVMTHTVRGWNWFGTLGQKYYRNRYALPIFSINRTLGKHIITAITNNIDVTVTGF
IQQQFRKQTNENPGVNSSNVVAYRNITHSPNDAIFVLGNRYDGWWGETPGDSGVGGAILL
GIAKYFNDNNITPKYNLTFLFTTGEEYGMRGAQHYVDSHPQGTGPGKYNFIAWIGFDQLG
FHYPPNVKHTFGLITNRLLTIKPILQEIERQTNYEKKTDYLYGFAAKAPLFIPVAAEDFV
WNDVCDTILFEKSGKNSGKWGGHHQVGENYTEGDSLQYIDRNDTNVTFEMAWNVTKYFTV
NPDCQFDGTITYTRTDSPDDKDSELDTITATMPIQSILPHDMVRIKAELRRDFFPYTIAH
TMTQDYIVTDETINYTINVTLPPDKPAGYHTLTLKLYNSTGRIDVIIWPHLYDTPEETET
SNSMFLKPRGNDPPITPTKPDGPISVKRWQKGHWNSTSPDPNSDRIGQKWFWNYDTFPNI
YTPTSLSDTDYFNKTHRYSILGRHQISVKAYDEYSTLWHPYESGYSEILEVQVTPWCSIS
KQQQTHQERVIHVVNGSSHQFYGLLSGGQSHLFEWDFHDQSQSRHSTEQNPTHTYTDLGV
YNVTFNVTDEATQLTGSTFIHVRVSDLDSDFNLSYYHGAAPNTVISFRNTSKAKTGNTVT
NITWDFDDGTISYESIVNHSFDVEGVYNVTLTVKDSENNIDVDYVILRISSEPELPEIPS
VQGPGVLPPNSEAAIIAEIIATDRNLSSVTVNITTPNGTTGNYTMTEVVDNIFIYTMGNT
SQNGYFNFTIWVTDIENNTNSTSGNFSMIVPLLYFDSPTPPHNMIENRNWVMVNVTVLDP
LSTSAFIDWNCSLKGYWPMDVYNTTGVYDNSSYGNFGRFCSTMNPENIRAGRYGNGVLFN
GEADYVDLGNSSSLDLGTGDFTFMVWEKSDVSSYQGNGVILTNQPGQEDWKGYGFGVVDG
AYLYAAQSSEEYVEVEGTVDVTDGDWHHLAYVHDDGYYSLYVDGVFDTKSKWISSYNITN
TQHTCLAYDGQTSGWCYFAGMLDELQLYNRAVSREEINASYNNGLFRLYHNFTGLTEGDY
LFYGHAVDTSGNMSQTETRTITIDFDPQIIGVFASPSTVGFGYNLTITANVTDTGSGVNT
VNVNITYPDETHGNYTMTHVTGDSYQYVFMDVWLAGQYNYTLWAMDHSNNSNSSSGHHFH
VSADASMSIATLQNSYTGDDYINITDPPNPPENYMVVARGLTWDKYYDAITGQNILEVST
GPVNYQGENGTWIPINATFSSLTGDHPAYVYGYRSGNDRGLYGVYFKSNAQLDWPVAFTY
NRSDDPTIHAIRSKLVGVGYVDPQSNWTYQYLQNVQSSQGQTNDYSITYPGVFTGADVIW
SYGNTGLKEEIILSNTTKTMLQNHPPSQYGLNDASSYLVFITKLDYQSLNLYNGSGVLDG
NVTISDIGVEFRDVLGQFRCALPLGEVYEMNNESMRHKLTYRIIHINGNTYLLSGLKVTD
LNTMMFPVAIDPTLTVYALFSDAYIEQSSTSYNAAWTASTGTVYDTADFITIGQYKFKTT
SYIYRGFVHFNTSSLPSNAYLDNATLSLYKRTDYSTADFDITIQNGQPTYPHDPVQPGDY
DKTCYLGNGGSLNTADLISGYNAISLTNLTWINTTGLTKLCLRSSRDISGTAPTGNEFVS
VYSREFIFSYPPKLVIYYRNQSKIKNTGSTDIKGYLLIQVQFYNSTQGKWLMDNDTINET
Download sequence
Identical sequences A0A2K3J104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]