SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2K3JGD8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K3JGD8
Domain Number 1 Region: 1207-1426
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.43e-32
Family Glycosyl hydrolases family 16 0.067
Further Details:      
 
Domain Number 2 Region: 428-561
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.11e-19
Family Bacterial dinuclear zinc exopeptidases 0.048
Further Details:      
 
Domain Number 3 Region: 855-986
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000000562
Family PKD domain 0.0017
Further Details:      
 
Domain Number 4 Region: 992-1071
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000017
Family PKD domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K3JGD8
Sequence length 2138
Comment (tr|A0A2K3JGD8|A0A2K3JGD8_9EURY) Uncharacterized protein {ECO:0000313|EMBL:PNX53091.1} OX=1933280 OS=Thermoplasmata archaeon M9B2D. GN=BV458_06315 OC=Archaea; Euryarchaeota; Thermoplasmata; unclassified Thermoplasmata.
Sequence
MRKKIVGIVVCMLLISSTTSMVLFSDTVKVEASGGGQQGVGCVNLDYDWVWFQVQEFANV
IRKVNWSQNGGNGIPKGRAWATAGENYTRDTILWPNMGITDNPCGLTGYTNLTIGYINSL
RPKQYSSKIIIKDYGLTISENGDLYKELSYSEMFPIGIGMIPWKEGGALNESWLTNTFGF
TDAEVRIRSLWNGGLIQDFREVSCEFLNTYNELDGQAVFLNTTDPLPENHDVVFILKEEP
ASEEKIQNLSDSEGIILIENSTKTYTFQNSSLFNCSIARLNGTDSNFIKVLSEIKNGSNY
TVDNFLHSEILIFSNYSNASCCPGPDYVIIVQLSKEGDYSKVMRRAKKWSLDGHCKGIIM
SGVNDSTHVMTHTVRGWNWFGTLGQKYYRNRYALPIFSINRTLGKHIITAITNNIDVTVT
GFIQQQFRKQTNENPGVNSSNVVAYRNITHSPNDAIFVLGNRYDGWWGETPGDSGVGGAI
LLGIAKYFNDNNITPKYNLTFLFTTGEEYGMRGAQHYVDSHPQGTGPGKYNFIAWIGFDQ
LGFHYPPNVKHTFGLITNRLLTIKPILQEIERQTNYEKKTDYLYGFAAKAPLFIPVAAED
FVWNDVCDTILFEKSGKNSGKWGGHHQVGENYTEGDSLQYIDRNDTNVTFEMAWNVTKYF
TVNPDCQFDGTITYTRTDSPDDKDSELDTITATMPIQSILPHDMVRIKAELRRDFFPYTI
AHTMTQDYIVTDETINYTINVTLPPDKPAGYHTLTLKLYNSTGRIDVIIWPHLYDTPEET
ETSNSMFLKPRGNDPPITPTKPDGPISVKRWQKGYWNSTSPDPNNDRIGQKWFWNYDTFP
NIYTPTSLSDTDYFNKTHRYSILGRHQISVKAYDEYSTLWHPYESGYSEILEVQVTPWCS
ISKQQQTHQERVIHVVNGSSHQFYGLLSGGQSHLFEWDFHDQSQSRHSTEQNPTHTYTDL
GVYNVTFNVTDEATQLTGSTFIHVRVSDLDSDFNLSYYHGAAPNTVISFRNTSKAKTGNT
VTNITWDFDDGTISYESIVNHSFDVEGVYNVTLTVKDSENNIDVDYVILRISSEPVLPEI
PSVQGPGVLPPNSEAAIIAEIIATDRNLSSVTVNITTPNGTTGNYTMTEVVDNIFIYTMG
NTSQNGYFNFTIWVTDIENNTNSTSGNFSMIVPLLYFDSPTPPHNMIENRNWVMVNVTVL
DPLSTSAFIDWNCSLKGYWPMDVYNTTGVYDNSSYGNFGRFCSTMNPENIRAGRYGNGVL
FNGEADYVDLGNSSSLDLGTGDFTFMVWEKSDVSSYQGNGVILTNQPGQEDWKGYGFGVV
DGAYLYAAQSSEEYVEVEGTVDVTDGDWHHLAYVHDDGYYSLYVDGVFDTKSKWISSYNI
TNTQHTCLAYDGQTSGWCYFAGMLDELQLYNRAVSREEINASYNNGLFRLYHNFTGLTEG
DYLFYGHAVDTSGNMSQTETRTITIDFDPQIIGVFASPSTVGFGYNLTITANVTDTGSGV
NTVNVNITYPDETHGNYTMTHVTGDSYQYVFMDVWLAGQYNYTLWAMDHSNNSNSSSGHH
FHVSADASMSIATLQNSYTGDDYINITDPPNPPENYMVVARGLTWDKYYDAITGQNILEV
STGPVNYQGENGTWIPINATFSSLTGDHPAYVYGYRSGNDRGLYGVYFKSNAQLDWPVAF
TYNRSDDPTIHAIRSKLVGVGYVDPQSNWTYQYLQNVQSSQGQTNDYSITYPGVFTGADV
IWSYGNTGLKEEIILSNTTKTMLQNHPPSQYGLNDASSYLVFITKLDYQSLNLYNGSGVL
DGNVTISDIGVEFRDVLGQFRCALPLGEVYEMNNESMRHKLTYRIIHINGNTYLLSGLKV
TDLNTMMFPVAIDPTLTVYAADFITIGQYKFKTTSYIYRGFVHFNTSSLPSNAYLDNATL
SLYKRTDYSTADFDITIQNGQPTYPHDPVQPGDYDKTCYLGNGGSLNTADLISGYNAISL
TNLTWINTTGLTKLCLRSGRDISGTAPTGNEFVSVYSKDFIFSYPPKLVIYYRNQSKIMN
TGSTDINGYLLMQVQYYNETLESWIVDNDTVNETTPRTINSSSQLGLDTIFNGQVRASDL
THGSGLYRVYAAFQDPEGNILRTNDETDLEAWWQFSKT
Download sequence
Identical sequences A0A2K3JGD8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]