SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2K5DEB1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5DEB1
Domain Number 1 Region: 22-282
Classification Level Classification E-value
Superfamily YWTD domain 1.02e-51
Family YWTD domain 0.00000168
Further Details:      
 
Domain Number 2 Region: 333-563
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-51
Family YWTD domain 0.00000278
Further Details:      
 
Domain Number 3 Region: 634-882
Classification Level Classification E-value
Superfamily YWTD domain 4.97e-45
Family YWTD domain 0.0000152
Further Details:      
 
Domain Number 4 Region: 929-1186
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-37
Family YWTD domain 0.0000725
Further Details:      
 
Domain Number 5 Region: 1317-1352
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000812
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1279-1315
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000445
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 589-635
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000561
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 8 Region: 1239-1277
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000576
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 9 Region: 885-932
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000838
Family EGF-type module 0.026
Further Details:      
 
Domain Number 10 Region: 288-330
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000921
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 11 Region: 1196-1248
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000884
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5DEB1
Sequence length 1597
Comment (tr|A0A2K5DEB1|A0A2K5DEB1_AOTNA) LDL receptor related protein 5 {ECO:0000313|Ensembl:ENSANAP00000019294} KW=Complete proteome OX=37293 OS=Aotus nancymaae (Ma's night monkey). GN=LRP5 OC=Platyrrhini; Aotidae; Aotus.
Sequence
MEAADLSPPVALTVCFCPIASPLLLFANRRDVRLVDAGRVKLETTIVVSGLEDAAAVDFQ
FSKGAVYWTDVSEEAIKQTYLNHTGVAVQNVVISGLVSPDGLACDWVGKKLYWTDSETNR
IEVANLNGTSRKVLFWQDLDQPRAIALNPAHGYMYWTDWGEMPRIERAGMDGSTRNIIVD
SDIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGDTLY
WTDWQTRSIHACNKRTGGKRKEILSALYSPMDIQVLSQERQPFFHTRCEEDNGGCSHLCL
LSPVEPFYTCACPTGVQLQDNGRTCKAGAEEVLLLARRTDLRRISLDTPDFTDIVLQVDD
IRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDGSGAQTLINTEINDPDGIAVDWVARNLY
WTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAIALHPVMGLMYWTDWGENPKIECANLDG
QERRVLVNASLGWPNGLALDLQEGKLYWGDAKTDKIEVINVDGTKRRTLLEDKLPHIFGF
TLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQLPDLMGLKAVNVAKIIGTNPCADENGG
CSHLCFFTPHSTRCGCPIGLELLSDMKTCIVPEAFLVFTSRAAIHRISLETNNNDVAIPL
TGVKEASALDFDVANNHIYWTDVSLKTISRAFLNRSSVEHVVEFGLDYPEGMNLYSADTG
TNRIEMAWLDRQFQQVLMWRDLDNPRSLALDPTKGYIYWTEWGGKPRIVRAFMDGTNCMT
LVDKVGRANDLTIDYTDQRLYWTDLDTNMIESSNMLGQERVVIADDLPHPFGLTQYSDYI
YWTDWNLHSIERADKTSGQNRTLIQGHLDFVMDILVFHSSRQDGLNDCVHDNGQCGQLCL
AIPGGHRCGCASHYTLDPSGRNCSPPTTFLLFSQKSAISRMIPDDQHSPDLILPLHGLRN
VKAIDYDPLDKFIYWVDGRQNIKRAKDDGTQPFVLTSLSQAQNPDRQPHDLSIDIYSRTL
FWTCEATNTINVHRLSGEAMGVVLRGDRDKPRAIIVNAERGYLYFTNMQDRAAKIERAAL
DGTEREVLFTTGLIRPVALVVDNALGKLFWADADLKRIESCDLSGANRLTLEDANIVQPL
GLTVLGKHLYWIDRQQQMIERVEKTTGDKRTRIQGRVTHLTGIHAVEEVSLEEFSAHPCA
RDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQFACATGEIDCIPGAW
RCDGFPECDDQSDEEGCPVCSAAQFPCARGQCVDLRLRCDGEADCQDRSDEADCDAICLP
NQFRCASGQCVLIKQQCDSFPDCIDGSDELMCEINKPPSDDTGAHSSAVGPVIGIILSLF
VMGGIYFVCQRVVCQRYTGANGPFPHEYVSGTPHVPLNFIAPGGSQHGPFTGIACGKSMM
SSVSLMGGRGGVPLYDRNHVTGASSSSSSSTKATLYPPILNPPPSPATDPSLYNMDMFYS
SNIPATARPYRPYIIRGMVPPTTPCSTDVCDSDYSASRWKASKYYLDLNSDSDPYPPPPT
PHSQYLSAEDSCPPSPATERSYFHLFPPPPSPCTDSS
Download sequence
Identical sequences A0A2K5DEB1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]