SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2K5DEB5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5DEB5
Domain Number 1 Region: 16-276
Classification Level Classification E-value
Superfamily YWTD domain 1.02e-51
Family YWTD domain 0.00000168
Further Details:      
 
Domain Number 2 Region: 327-557
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-51
Family YWTD domain 0.00000278
Further Details:      
 
Domain Number 3 Region: 628-876
Classification Level Classification E-value
Superfamily YWTD domain 4.97e-45
Family YWTD domain 0.0000152
Further Details:      
 
Domain Number 4 Region: 923-1180
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-37
Family YWTD domain 0.0000725
Further Details:      
 
Domain Number 5 Region: 1311-1346
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000812
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1273-1309
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000445
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 583-629
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000554
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 8 Region: 1233-1271
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000563
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 9 Region: 879-926
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000838
Family EGF-type module 0.026
Further Details:      
 
Domain Number 10 Region: 282-324
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000921
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 11 Region: 1190-1242
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000884
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K5DEB5
Sequence length 1591
Comment (tr|A0A2K5DEB5|A0A2K5DEB5_AOTNA) LDL receptor related protein 5 {ECO:0000313|Ensembl:ENSANAP00000019292} KW=Complete proteome OX=37293 OS=Aotus nancymaae (Ma's night monkey). GN=LRP5 OC=Platyrrhini; Aotidae; Aotus.
Sequence
DPGLALTVCFCPIASPLLLFANRRDVRLVDAGRVKLETTIVVSGLEDAAAVDFQFSKGAV
YWTDVSEEAIKQTYLNHTGVAVQNVVISGLVSPDGLACDWVGKKLYWTDSETNRIEVANL
NGTSRKVLFWQDLDQPRAIALNPAHGYMYWTDWGEMPRIERAGMDGSTRNIIVDSDIYWP
NGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQT
RSIHACNKRTGGKRKEILSALYSPMDIQVLSQERQPFFHTRCEEDNGGCSHLCLLSPVEP
FYTCACPTGVQLQDNGRTCKAGAEEVLLLARRTDLRRISLDTPDFTDIVLQVDDIRHAIA
IDYDPLEGYVYWTDDEVRAIRRAYLDGSGAQTLINTEINDPDGIAVDWVARNLYWTDTGT
DRIEVTRLNGTSRKILVSEDLDEPRAIALHPVMGLMYWTDWGENPKIECANLDGQERRVL
VNASLGWPNGLALDLQEGKLYWGDAKTDKIEVINVDGTKRRTLLEDKLPHIFGFTLLGDF
IYWTDWQRRSIERVHKVKASRDVIIDQLPDLMGLKAVNVAKIIGTNPCADENGGCSHLCF
FTPHSTRCGCPIGLELLSDMKTCIVPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVKEA
SALDFDVANNHIYWTDVSLKTISRAFLNRSSVEHVVEFGLDYPEGMNLYSADTGTNRIEM
AWLDRQFQQVLMWRDLDNPRSLALDPTKGYIYWTEWGGKPRIVRAFMDGTNCMTLVDKVG
RANDLTIDYTDQRLYWTDLDTNMIESSNMLGQERVVIADDLPHPFGLTQYSDYIYWTDWN
LHSIERADKTSGQNRTLIQGHLDFVMDILVFHSSRQDGLNDCVHDNGQCGQLCLAIPGGH
RCGCASHYTLDPSGRNCSPPTTFLLFSQKSAISRMIPDDQHSPDLILPLHGLRNVKAIDY
DPLDKFIYWVDGRQNIKRAKDDGTQPFVLTSLSQAQNPDRQPHDLSIDIYSRTLFWTCEA
TNTINVHRLSGEAMGVVLRGDRDKPRAIIVNAERGYLYFTNMQDRAAKIERAALDGTERE
VLFTTGLIRPVALVVDNALGKLFWADADLKRIESCDLSGANRLTLEDANIVQPLGLTVLG
KHLYWIDRQQQMIERVEKTTGDKRTRIQGRVTHLTGIHAVEEVSLEEFSAHPCARDNGGC
SHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQFACATGEIDCIPGAWRCDGFP
ECDDQSDEEGCPVCSAAQFPCARGQCVDLRLRCDGEADCQDRSDEADCDAICLPNQFRCA
SGQCVLIKQQCDSFPDCIDGSDELMCEINKPPSDDTGAHSSAVGPVIGIILSLFVMGGIY
FVCQRVVCQRYTGANGPFPHEYVSGTPHVPLNFIAPGGSQHGPFTGIACGKSMMSSVSLM
GGRGGVPLYDRNHVTGASSSSSSSTKATLYPPILNPPPSPATDPSLYNMDMFYSSNIPAT
ARPYRPYIIRGMVPPTTPCSTDVCDSDYSASRWKASKYYLDLNSDSDPYPPPPTPHSQYL
SAEDSCPPSPATERSYFHLFPPPPSPCTDSS
Download sequence
Identical sequences A0A2K5DEB5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]