SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2K5ECW8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5ECW8
Domain Number 1 Region: 676-822
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.7e-40
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 
Domain Number 2 Region: 1002-1101
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.68e-30
Family Ras-binding domain, RBD 0.00083
Further Details:      
 
Domain Number 3 Region: 216-372
Classification Level Classification E-value
Superfamily PH domain-like 5.45e-22
Family Phosphotyrosine-binding domain (PTB) 0.014
Further Details:      
 
Domain Number 4 Region: 11-105
Classification Level Classification E-value
Superfamily PDZ domain-like 9.98e-20
Family PDZ domain 0.0091
Further Details:      
 
Domain Number 5 Region: 947-1016
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000207
Family Ras-binding domain, RBD 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5ECW8
Sequence length 1357
Comment (tr|A0A2K5ECW8|A0A2K5ECW8_AOTNA) Regulator of G protein signaling 12 {ECO:0000313|Ensembl:ENSANAP00000031061} KW=Complete proteome OX=37293 OS=Aotus nancymaae (Ma's night monkey). GN=RGS12 OC=Platyrrhini; Aotidae; Aotus.
Sequence
MYRAGEAAKRPLPGPVPLRVRSVEVARGRAGYGFTLSGQAPCVLSCVMRGSPADFVGLRA
GDQIFAVNEINVKKASHEDVVKLIGKCSGVLHMVIAEGIGHFESCSSDEEGGLYEGKGWL
KPKLDSKALGINRAERVVEEMQSGGIFNMIFENPSLCASSSEPLRLKQRSLSESAAARFD
VGHESVNNPNPSMLSKEEISKVIHDDSVFSIGLEGHDDFALDASILNVAMIVGYLGSIEL
PSTSSNLESDSLQAIRGCMRRLRAEQKIHSLVTMKIMHDCVQLGTDKAGVVAEYPAEKLA
FSAVCPDDRRFFGLVTMQTNDDGSLAQEEEGALRTSCHVFMVDPDLFHHKIHQGIARRFG
FECTADPDTNGCLEFPASSLPVLQFISVLYRDMGELIEGMRARAFLDGDADAQQNNSTSS
NSDSGIGNFNQEEKSNRVLVVDLGGSSSRHGPGGSAWDGVGGRGAQPWGIPWTGPLCPDP
EGSPPFEAAHQPDRFRDLSKHLGPASPVELPPASSRSSVPPSKRGTVGASSAFNQRWLPV
HVLREWQCGHASDQESYTDSTDGWSSVNCGTLPPPMSKIPADRYRVEGSAPKREWSRKAF
GMQNIFGPHRNVRKTKEDKKGSKFGRGIGLTQPSPRTPARRSFGRSKRFSITRSLDDLEL
TGADLKDCVSNNSLSSNASLPSVQSCRRLRERRVASWAVSFERLLQDPVGVRYFSDFLRK
EFSEENILFWQACEYFNHVPAHDKKELSYRAREIFSKFLCSKATTPVNIDSQAQLADDVL
RAPHPDMFKEQQLQIFNLMKFDSYTRFLKSPLYQECILAEVEGRALPDSQQVPSSPASKH
SLGSDHSSVSTPKKLNGKSKSGRSLNEELGDEDSEKRRKGAFFLWSRTRSTGRSQKKREH
GDHADDPLHANGGLCRRESQGSVSSSGSLDLSEACRTLAPEKDKATKHCCVHLPDGTSCV
VAVKAGFSIKEILSGLCERHGINGAAADLFLVGGDKPLVLHQDSSILESRDLRLEKRTLF
RLDLVPINRSVGLKAKPTKPVTEVLRPVVAKYGLDLGGLLVRLSGEKEPLDLGAPISSLD
GQRVVLEEKDPSRGKASTDKQKGAPVKQNTAVNSSSRNHSATGEERTLGKSNSIKIKGEN
GKNARDPRLSKREESIAKIGKKKYQKINLDEAEEFFELISKAQSNRADDQRGLLRKEDLV
LPEFLRLPPGSTELTLPTAAAMAKGFSKRGTAGSASQPSEQWEPSQESSDSPSTSPGSAP
SPPGPPGTTSPGQKSPSGAFCTPQSPGSLEQEGTAQIWKRQSREVEAEGIQTVEDEHVAE
LTLMGEGDISSPNSTLLPPPSAPQDALEPSRPGTSRF
Download sequence
Identical sequences A0A2K5ECW8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]