SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2K5ETW6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5ETW6
Domain Number 1 Region: 155-316,354-416
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.97e-43
Family Voltage-gated potassium channels 0.0025
Further Details:      
 
Domain Number 2 Region: 419-606
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.18e-41
Family cAMP-binding domain 0.0026
Further Details:      
 
Domain Number 3 Region: 6-74
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000126
Family Flavin-binding PAS domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5ETW6
Sequence length 624
Comment (tr|A0A2K5ETW6|A0A2K5ETW6_AOTNA) Uncharacterized protein {ECO:0000313|Ensembl:ENSANAP00000036667} KW=Complete proteome OX=37293 OS=Aotus nancymaae (Ma's night monkey). GN= OC=Platyrrhini; Aotidae; Aotus.
Sequence
MQKSSTCSFMYGELTDKKTIEKVRQTFDNYESNCFEVLLYKKNRTPVWFYMQIAPIRNEH
EKVVLFLCTFKDITLFKQPIEDDSTKGWTKFARLTRALTNSRSVLQQLTPMNKTEVVHKH
SRLAEVLQLGSDILPQYKQEAPKTPPHIILHYCAFKTTWDWVILILTFYTAIMVPYNVSF
KTKQNNIAWLVLDSVVDVIFLVDIVLNFHTTFVGPGGEVISDPKLIRMNYLKTWFVIDLL
SCLPYDIINAFENVDEGISSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLVLLVCVFGL
VAHWLACIWYSIGDYEVIDEVTNTIQIDSWLYQLALSIGTPYRYNTSAGIWEGGPSKDSL
YVSSLYFTMTSLTTIGFGNIAPTTDVEKMFSVAMMMVGSLLYATIFGNVTTIFQQMYANT
NRYHEMLNNVRDFLKLYQVPKGLSERVMDYIVSTWSMSKGIDTEKVLSICPKDMRADICV
HLNRKVFNEHPAFRLASDGCLRALAVEFQTIHCAPGDLIYHAGESVDALCFVVSGSLEVI
QDDEVVAILGKGDVFGDIFWKETTLAHACANVRALTYCDLHIIKREALLKVLDFYTAFAN
SFSRNLTLTCNLRKRGWFSMANAL
Download sequence
Identical sequences A0A2I3SM55 A0A2J8WLM4 A0A2K5ETW6 A0A2K5IMQ1
gi|27886648|ref|NP_758964.1| ENSP00000378419 ENSP00000378419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]