SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2K5KC79 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5KC79
Domain Number 1 Region: 641-896
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-55
Family YWTD domain 0.00000599
Further Details:      
 
Domain Number 2 Region: 29-289
Classification Level Classification E-value
Superfamily YWTD domain 6.41e-54
Family YWTD domain 0.00000161
Further Details:      
 
Domain Number 3 Region: 340-570
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-51
Family YWTD domain 0.00000282
Further Details:      
 
Domain Number 4 Region: 943-1200
Classification Level Classification E-value
Superfamily YWTD domain 6.8e-38
Family YWTD domain 0.0000699
Further Details:      
 
Domain Number 5 Region: 1331-1367
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000072
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1293-1329
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000445
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1253-1291
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000576
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 8 Region: 596-642
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000276
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 9 Region: 899-946
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000132
Family EGF-type module 0.02
Further Details:      
 
Domain Number 10 Region: 295-337
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000067
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1210-1262
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000986
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K5KC79
Sequence length 1611
Comment (tr|A0A2K5KC79|A0A2K5KC79_COLAP) LDL receptor related protein 5 {ECO:0000313|Ensembl:ENSCANP00000038698} KW=Complete proteome; Reference proteome OX=336983 OS=Colobus angolensis palliatus (Peters' Angolan colobus). GN=LRP5 OC=Catarrhini; Cercopithecidae; Colobinae; Colobus.
Sequence
QVIHPPRPPKVLGLQPMALTVCFCPTASPLLLFANRRDVRLVDAGGVKLESTIVVSGLED
AAAVDFQFSKGAVYWTDVSEEAIKQTYLNQTGAAVQNVVISGLVSPDGLACDWVGKKLYW
TDSETNRIEVANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDGS
TRKIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALT
LSGDTLYWTDWQTRSIHACNKRTGGKRKEILSALYSPMDIQVLSQERQPFFHTRCEEDNG
GCSHLCLLSPREPFYTCACPTGVQLQDNGRTCKAGAEEVLLLARRTDLRRISLDTPDFTD
IVLQVDDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDGSGAQTLVNTEINDPDGIAVD
WVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAIALHPVMGLMYWTDWGENPKI
ECANLDGQERRVLVNASLGWPNGLALDLQEGKLYWGDAKTDKIEVINVDGTKRRTLLEDK
LPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQLPDLMGLKAVNVAKVVGTNP
CADRNGGCSHLCFFTPHATQCGCPVGLELLSDMKTCIVPEAFLVFTSRAAIHRISLETNN
NDVAIPLTGVKEASALDFDVSNNHIYWTDVSLKTISRAFMNGSSVEHVVEFGLDYPEGMA
VDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPRSLALDPTKGYIYWTEWGGKP
RIVRAFMDGTNCMTLVDKVGRANDLTIDYADQRLYWTDLDTNMIESSNMLGQERVVIADD
LPHPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQGHLDFVMDILVFHSSRQDGLN
DCMHNNGQCGQLCLAIPGGHRCGCASHHTLDPSSRNCSPPTTFLLFSQKSAISRMIPDDQ
HSPDLILPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRAKDDGTQPFVLTSLSQGQNPDR
QPHDLSIDIYSRTLFWTCEATNTINVHRLSGEAMGVVLRGDRDKPRAIVVNAERGYLYFT
NMQDRAAKIERAALDGTEREVLFTTGLIRPVALAVDNTLGKLFWVDADLKRIESCDLSGA
NRLTLEDANIVQPLGLTVLGKHLYWIDRQQQMIERVEKTTGDKRTRVQGRVAHLTGIHAV
EEVSLEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQF
ACATGEIDCIPGAWRCDGFPECDDQSDEEGCPVCSAAQFPCARGQCVDLRLRCDGEADCQ
DRSDEADCDAICLPNQFRCASGQCVLIKQQCDSFPDCIDGSDELMCEITKPPSDDSPAHS
SAIGPVIGIILSLFVMGGVYFVCQRVVCQRYAGANGPFPHEYVSGTPHVPLNFIAPGGSQ
HGPFTGIACGKSMMSSVSLMGGRGGVPLYDRNHVTGASSSSSSSTKATLYPPILNPPPSP
ATDPSLYNMDMFYSSNIPATARPYRPYIIRGMAPPTTPCSTDVCDSDYSASRWKASKYYL
DLNSDSDPYPPPPTPHSQYMSAEDSCPPSPATERSYFHLFPPPPSPCTDSS
Download sequence
Identical sequences A0A2K5KC79

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]