SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2K5KC82 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5KC82
Domain Number 1 Region: 640-895
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-55
Family YWTD domain 0.00000599
Further Details:      
 
Domain Number 2 Region: 28-288
Classification Level Classification E-value
Superfamily YWTD domain 6.41e-54
Family YWTD domain 0.00000161
Further Details:      
 
Domain Number 3 Region: 339-569
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-51
Family YWTD domain 0.00000282
Further Details:      
 
Domain Number 4 Region: 942-1199
Classification Level Classification E-value
Superfamily YWTD domain 6.8e-38
Family YWTD domain 0.0000699
Further Details:      
 
Domain Number 5 Region: 1330-1366
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000707
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1292-1328
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000445
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1252-1290
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000576
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 8 Region: 595-641
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000261
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 9 Region: 898-945
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000153
Family EGF-type module 0.02
Further Details:      
 
Domain Number 10 Region: 294-336
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000861
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1209-1261
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000931
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K5KC82
Sequence length 1610
Comment (tr|A0A2K5KC82|A0A2K5KC82_COLAP) LDL receptor related protein 5 {ECO:0000313|Ensembl:ENSCANP00000038699} KW=Complete proteome; Reference proteome OX=336983 OS=Colobus angolensis palliatus (Peters' Angolan colobus). GN=LRP5 OC=Catarrhini; Cercopithecidae; Colobinae; Colobus.
Sequence
MGRAVPGCCIPGLCPMALTVCFCPTASPLLLFANRRDVRLVDAGGVKLESTIVVSGLEDA
AAVDFQFSKGAVYWTDVSEEAIKQTYLNQTGAAVQNVVISGLVSPDGLACDWVGKKLYWT
DSETNRIEVANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDGST
RKIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTL
SGDTLYWTDWQTRSIHACNKRTGGKRKEILSALYSPMDIQVLSQERQPFFHTRCEEDNGG
CSHLCLLSPREPFYTCACPTGVQLQDNGRTCKAGAEEVLLLARRTDLRRISLDTPDFTDI
VLQVDDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDGSGAQTLVNTEINDPDGIAVDW
VARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAIALHPVMGLMYWTDWGENPKIE
CANLDGQERRVLVNASLGWPNGLALDLQEGKLYWGDAKTDKIEVINVDGTKRRTLLEDKL
PHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQLPDLMGLKAVNVAKVVGTNPC
ADRNGGCSHLCFFTPHATQCGCPVGLELLSDMKTCIVPEAFLVFTSRAAIHRISLETNNN
DVAIPLTGVKEASALDFDVSNNHIYWTDVSLKTISRAFMNGSSVEHVVEFGLDYPEGMAV
DWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPRSLALDPTKGYIYWTEWGGKPR
IVRAFMDGTNCMTLVDKVGRANDLTIDYADQRLYWTDLDTNMIESSNMLGQERVVIADDL
PHPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQGHLDFVMDILVFHSSRQDGLND
CMHNNGQCGQLCLAIPGGHRCGCASHHTLDPSSRNCSPPTTFLLFSQKSAISRMIPDDQH
SPDLILPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRAKDDGTQPFVLTSLSQGQNPDRQ
PHDLSIDIYSRTLFWTCEATNTINVHRLSGEAMGVVLRGDRDKPRAIVVNAERGYLYFTN
MQDRAAKIERAALDGTEREVLFTTGLIRPVALAVDNTLGKLFWVDADLKRIESCDLSGAN
RLTLEDANIVQPLGLTVLGKHLYWIDRQQQMIERVEKTTGDKRTRVQGRVAHLTGIHAVE
EVSLEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQFA
CATGEIDCIPGAWRCDGFPECDDQSDEEGCPVCSAAQFPCARGQCVDLRLRCDGEADCQD
RSDEADCDAICLPNQFRCASGQCVLIKQQCDSFPDCIDGSDELMCEITKPPSDDSPAHSS
AIGPVIGIILSLFVMGGVYFVCQRVVCQRYAGANGPFPHEYVSGTPHVPLNFIAPGGSQH
GPFTGIACGKSMMSSVSLMGGRGGVPLYDRNHVTGASSSSSSSTKATLYPPILNPPPSPA
TDPSLYNMDMFYSSNIPATARPYRPYIIRGMAPPTTPCSTDVCDSDYSASRWKASKYYLD
LNSDSDPYPPPPTPHSQYMSAEDSCPPSPATERSYFHLFPPPPSPCTDSS
Download sequence
Identical sequences A0A2K5KC82

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]