SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2K5LNE8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5LNE8
Domain Number 1 Region: 1091-1222,1285-1351
Classification Level Classification E-value
Superfamily Hemopexin-like domain 8.7e-39
Family Hemopexin-like domain 0.0009
Further Details:      
 
Domain Number 2 Region: 69-108
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000248
Family Somatomedin B domain 0.0011
Further Details:      
 
Domain Number 3 Region: 27-67
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000183
Family Somatomedin B domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5LNE8
Sequence length 1351
Comment (tr|A0A2K5LNE8|A0A2K5LNE8_CERAT) Proteoglycan 4 {ECO:0000313|Ensembl:ENSCATP00000014476} KW=Complete proteome; Reference proteome OX=9531 OS=Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys). GN=PRG4 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Cercocebus.
Sequence
MAWKTLPIYLLLLLSVFVIQQVSSQDLSSCAGRCGEGYSRDATCNCDYNCQHYMECCPDF
KRVCTVELSCKGRCFESFERGRECDCDAQCKKYDKCCPDYESFCAEVHNPTSPPSAKKAP
PPSGASQTIKSTTKRSPKPPNKKKTKKVVESEEITEEHSVSENQESSSSSSSSSSSSTIR
KIKSSKNSAANRELQKKLKGKDNKKNRTKKKPTPKPPVVDEAGSGLDNGDFKVTTTPATS
TTQHNKVTTSPKITTAKPKNPRPSLPPNSDTSKQTSLTTNKETTVETQEPTTTNKQTSTD
GKETTSAKATQSVEKTSAKDLAPTSKVPAKPTPKAETTTKGPALTTPKEPTPTTPKEPAS
TTPKEPAPTTTKSAPTTPKEPAPTTPKEPAPTTTKKPAPTTPKEPAPTTPKEPAPTTTKE
PAPTTPKEPAPTTPKEPAPTTTKEPAPTIPKEPAPTTPKELTPTTPKEPVPTPPKEPAPT
TPKEPVPTPPKEPAPTTPKKPAPTTTKKPAPTTPKEPAPTTTKEPAPTTPKEPAPTTTKE
PAPTTPKEPAPTIPEELVPTTPEELTPTTPEEPTPTIPAELAPTTPEEPAPTTPKAPAPT
TPKEPAPKTAPTTPKEPAPTTPKGTAPTTLKETAPTTPKETAPTTPKGTAPTTPKGTAPT
TLKETAPTTPKGTAPTTPKGTAPTTLKETAPTTPKETAPTTPKGTAPTTPKGTAPTTLKE
TAPTTPEGTAPTTLNEPAPTTPKQPAPKELAPTTTKEPTPTTSDKPAPTTPKEPAPTTPK
KPAPTTPETPPATTSEASTPTTTMEPPTSHKSPDESTPELSAEPTPKVLEKSPKKPSVPT
TKTPAVTKSEMTTIAKDKITERDIRTTPETTTVAPKMTKETATTTEKTTESKITTTTTQV
TSTTTQDTTPFKITTFKTTTLAPKVTTTTKKTITTTEIMNKPEETAKPKDRATNSKATTA
KPQKPTKAPKKPTSTKKPTSTKKPKTPPRVRKPKTTPTPPKMTSTMPELNPTSRVAEAML
QTTTRPNQTPNSKLVEVNPKNEDAGGAEGETPHMLPRPHVFTPIVIPGMDYSLRVPNQGI
IINPMLSDETDICNGRPVDGLTTLRNGTLVAFRGHYFWMLSPFSPPSPARRITEVWGIPS
PIDTVFTRCNCEGKTFFFKDSQYWRFTNDIKDAGYPKPIVKGFGGLTGQIVAALSIAKYK
NRPESVYFFKRGGSIQQYIYKQEPVQKCPGRRPALNYPVYGETTQVRRRRFERAIGPSLT
HTIRIHYSPVRLAYQDKGFLHNEVKVSTLWRGLPNVVTSAISLPNIRTPDGYDYYAFSKD
QYYNIDVPSRTARAITTRSGQTLSKVWYNCP
Download sequence
Identical sequences A0A2K5LNE8
XP_011902619.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]