SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5M4Y2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5M4Y2
Domain Number 1 Region: 19-121
Classification Level Classification E-value
Superfamily Immunoglobulin 3.38e-26
Family V set domains (antibody variable domain-like) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K5M4Y2
Sequence length 123
Comment (tr|A0A2K5M4Y2|A0A2K5M4Y2_CERAT) V-set pre-B cell surrogate light chain 3 {ECO:0000313|Ensembl:ENSCATP00000020258} KW=Complete proteome; Reference proteome OX=9531 OS=Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys). GN=VPREB3 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Cercocebus.
Sequence
MACWCLSFLLMGTFLSVSQTVLAQPDALLVFPGQVAQLSCTLSPQHVTIRDYGVSWYQQR
AGSAPRYLLYYRSEEDHHRPADIPDRFSAAKDEAHNACVLTISPVQPEDDADYYCSVGYS
FGP
Download sequence
Identical sequences A0A2K5M4Y2 A0A2K5Y552 A0A2K6BRF2 A0A2K6LJ40 G8F1D9 G8F609
ENSMMUP00000018487 ENSMMUP00000018487 9544.ENSMMUP00000018487 XP_011766706.1.29376 XP_011823336.1.47321 XP_011944987.1.92194 XP_015005321.1.72884 XP_015300005.1.63531 XP_017744992.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]