SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5MY80 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5MY80
Domain Number 1 Region: 59-252
Classification Level Classification E-value
Superfamily Sec7 domain 1.96e-81
Family Sec7 domain 0.00000000414
Further Details:      
 
Domain Number 2 Region: 261-376
Classification Level Classification E-value
Superfamily PH domain-like 3.22e-35
Family Pleckstrin-homology domain (PH domain) 0.00000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K5MY80
Sequence length 398
Comment (tr|A0A2K5MY80|A0A2K5MY80_CERAT) Cytohesin 1 {ECO:0000313|Ensembl:ENSCATP00000030197} KW=Complete proteome; Reference proteome OX=9531 OS=Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys). GN=CYTH1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Cercocebus.
Sequence
MEEDDSYVPSDLTAEERQELENIRRRKQELLADIQRLKDEIAEVANEIENLGSTEERKNM
QRNKQVAMGRKKFNMDPKKGIQFLIENDLLKNTCEDIAQFLYKGEGLNKTAIGDYLGERD
EFNIQVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNNGVF
QSTDTCYVLSFAIIMLNTSLHNPNVKDKPTVERFIAMNRGINDGGDLPEELLRNLYESIK
NEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKE
PRGIIPLENLSIREVEDSKKPNCFELYIPDNKDQVIKACKTEADGRVVEGNHTVYRISAP
TPEEKEEWIKCIKAAISRDPFYEMLAARKKKVSSTKRH
Download sequence
Identical sequences A0A2I3LJB6 A0A2J8Y1V2 A0A2K5MY80 A0A2K5TR90 H9G1V0 K7DDV9 Q15438 Q76MZ1
9606.ENSP00000354398 ENSP00000354398 NP_004753.1.87134 NP_004753.1.92137 XP_011897639.1.92194 XP_012611728.1.48125 ENSP00000354398 ENSP00000389095 gi|4758964|ref|NP_004753.1| ENSP00000354398 ENSP00000389095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]