SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2K5PU29 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5PU29
Domain Number 1 Region: 960-1096,1154-1220
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.09e-39
Family Hemopexin-like domain 0.0009
Further Details:      
 
Domain Number 2 Region: 69-108
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000262
Family Somatomedin B domain 0.0012
Further Details:      
 
Domain Number 3 Region: 27-67
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000183
Family Somatomedin B domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5PU29
Sequence length 1220
Comment (tr|A0A2K5PU29|A0A2K5PU29_CEBCA) Proteoglycan 4 {ECO:0000313|Ensembl:ENSCCAP00000007126} KW=Complete proteome OX=1737458 OS=Cebus capucinus imitator. GN=PRG4 OC=Platyrrhini; Cebidae; Cebinae; Cebus.
Sequence
MAWKALPIYLLLLLSVFLIQQVSSQDLSSCAGRCGEGYSRDATCSCDFNCQHYLDCCLDF
KRACTVELSCKGRCFESFERGRECDCDAQCKKYGKCCPDYGSFCEEVHNPTSPPSSKKAP
PAPGASQTIKSTTKRSPKPPNKKKTKKVVESEEITEVKDNKKNRAKKTHAPKPPVEDEAG
SGLDNDDFKVTTTPDTPTTQHNKVTTSPKTTTAKSINPRPSLPPNPDTTKETSLTANKET
TVETNETTKTNKQTSTDAKEKTTAAKETKSVEKTSAKDLAPTTKVPATPTLKAETTTKGP
ALTISKESAPTTPKQPAPTTTKKPAPTTPKEPAPTTPKEPAPTTPKEPSPTTPKERAPTT
PKEPSPTTPKEPASTTTKKPAPITTKEPAPTTTKKPVLTTPKEPAPTTPKEAASTTPKEP
APTTTKKPPAPTTPKKPAPTTPKEPAPTTSKKPAPTTPKELTPTTMDEPAFTTPEEPVPT
TPEEPAPTTPEEPAPTTPEEPVPTTPEEPAPTTVDEPAFTTPEEPAPTTPEEPAPTTPEE
PAPTTPEEPAPTTPKAPAPTTPKEPAPTTPKESAHNTPKEPVPTMTKEPAPTTPKELVTT
TTKEPTPATSDEPAPTTPKESAPTTPKEPAPTTPKEPEPAPTTPKKPELTTPKKPELTTP
KKPEPTTPKKPAPTTPETPPPTTSEVSTPATTMEPPTSTESPDESTPEFSVEPTTKTPAL
TNPEMPTTAKDKTEKDIRTTPETTTAALKMTKETTEKTTESKITSTNTQVTSTTTQDTTP
FKITTLRATTLAPKVTTTTKKTIATTEIMNTPEQTANPKDTATNSKATTPKPQKPKAPKK
PTSTKKPTSTKKPKTTPRVRKPKTTPTPHKMTSTMPELNPTTTVAEAMIQTTTRPNQTPD
SRLVEVNPKNEGANGADGETPHMIFRPHVFTPIVVPGVDYLLRVPNQGIFINPMLSDETN
ICNGKPVDGLTTLRNGTLVAFRGHYFWMLSPFSPPSPARRITEVWGIPSPIDTVFTRCNC
EGKTFFFKDSQYWRFTNDIKDAGYPKPIVKGFRGLTGQIVAALSIAKYKNRPESVYFFKR
GGNIQKYIYKQEPVQKCPGRRPALNYPVYGETTQVRRRRLERAIGPSQTHTIRIHYSPVR
LPYQDKDFLHNEVKVSTLWRGLPNMVTSAIALPNIRKPDGYDYYAFSKDQYYNMDVPSRT
ARAITTRSGQTLSKVWYNCP
Download sequence
Identical sequences A0A2K5PU29

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]