SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2K5RRV6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5RRV6
Domain Number 1 Region: 5-219
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.9e-68
Family D-ribulose-5-phosphate 3-epimerase 0.00000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K5RRV6
Sequence length 228
Comment (tr|A0A2K5RRV6|A0A2K5RRV6_CEBCA) Uncharacterized protein {ECO:0000313|Ensembl:ENSCCAP00000030836} KW=Complete proteome OX=1737458 OS=Cebus capucinus imitator. GN= OC=Platyrrhini; Cebidae; Cebinae; Cebus.
Sequence
MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQ
LGQDPFFDMHMMVSKPEQWVKPMAIAGANQYTFHLEATENPGALIKDIRENGMKVGLAIK
PGTSVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGP
DTVHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEAAQKRSLDR
Download sequence
Identical sequences A0A2K5CE23 A0A2K5RRV6 A0A2K6SC06 F6YQT5
XP_002749783.1.60252 XP_010334676.1.74449 XP_012301422.1.9421 XP_017402286.1.71028 ENSCJAP00000019988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]