SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2K5S631 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5S631
Domain Number 1 Region: 25-285
Classification Level Classification E-value
Superfamily YWTD domain 1.03e-51
Family YWTD domain 0.00000168
Further Details:      
 
Domain Number 2 Region: 336-566
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-51
Family YWTD domain 0.00000266
Further Details:      
 
Domain Number 3 Region: 637-885
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-51
Family YWTD domain 0.00000695
Further Details:      
 
Domain Number 4 Region: 932-1189
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-37
Family YWTD domain 0.0000725
Further Details:      
 
Domain Number 5 Region: 1320-1355
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000511
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 1282-1318
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000445
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 592-638
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000561
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 8 Region: 1242-1280
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000576
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 9 Region: 888-935
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000067
Family EGF-type module 0.026
Further Details:      
 
Domain Number 10 Region: 291-333
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000837
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 11 Region: 1199-1251
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000986
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K5S631
Sequence length 1600
Comment (tr|A0A2K5S631|A0A2K5S631_CEBCA) LDL receptor related protein 5 {ECO:0000313|Ensembl:ENSCCAP00000035852} KW=Complete proteome OX=1737458 OS=Cebus capucinus imitator. GN=LRP5 OC=Platyrrhini; Cebidae; Cebinae; Cebus.
Sequence
CPQMSPGPVWLPMALTVCFCPTASPLLLFANRRDVRLVDAGRVKLETTVVVSGLEDAAAV
DFQFSKGAVYWTDVSEEAIKQTYLNHTGVAVQNVVISGLVSPDGLACDWVGKKLYWTDSE
TNRIEVANLNGTSRKVLFWQDLDQPRAIALNPAHGYMYWTDWGEMPRIERAGMDGSTRNI
IVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGD
TLYWTDWQTRSIHACNKRTGGKRKEILSALYSPMDIQVLSQERQPFFHTRCEEDNGGCSH
LCLLSPMEPFYTCACPTGVQLQDNGRTCKAGAEEVLLLARRTDLRRISLDTPDFTDIVLQ
VDDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDGSGAQTLINTEINDPDGIAVDWVAR
NLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAIALHPVMGLMYWTDWGENPKIECAN
LDGQERRVLVNASLGWPNGLALDLQEGKLYWGDTKMDKIEVINVDGTKRRTLLEDKLPHI
FGFTLLGDFIYWTDWQRRSIERVHKVKASRDIIIDQLPDLMGLKAVNVAKIIGTNPCADE
NGGCSHLCFFTPHSTRCGCPIGLELLSDMKTCIVPEAFLVFTSRAAIHRISLETNNNDVA
IPLTGVKEASALDFDVANNHIYWTDVSLKVACSVEHVVEFGLDYPEGMAVDWMGKNLYWA
DTGTNRIEVARLDGQFRQVLVWRDLDNPRSLALDPTEGYIYWTEWGGKPRIVRAFMDGTN
CMTLVDKVGRANDLTIDYTDQRLYWTDLDTNMIESSNMLGQERVVIADDLPHPFGLTQYS
DYIYWTDWNLHSIERADKTSGQNRTLIQGHLDFVMDILVFHSSRQDGLNDCVHDNGQCGQ
LCLAIPGGHRCGCASHYTLDPSGRNCSPPSTFLLFSQKSAISRMIPDDQHSPDLILPLHG
LRNVKAIDYDPLDKFIYWVDGRQNIKRAKDDGTQPFVLTSLSQAQNPDRQPHDLSIDIYS
RTLFWTCEATNTINVHRLSGEAMGVVLRGDRDKPRAIIVNAERGYLYFTNMQDRAAKIER
AALDGTEREVLFTTGLIRPVALVVDNALGKLFWADADLKRIESCDLSGANRLTLEDANIV
QPLGLTVLGKHLYWIDRQQQMIERVEKTTGDKRTRIQGRVTHLTGIHAVEEVSLEEFSAH
PCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQFACATGEIDCIP
GAWRCDGFPECDDQSDEEGCPVCSAAQFPCARGQCVDLRLRCDGEADCQDRSDEADCDAI
CLPNQFRCANGQCVLIKQQCDSFPDCIDGSDELMCEINKPPSDDTGAHSSAIGPVIGIIL
SLFVMGGIYFVCQRVVCQRYAGASGPFPHEYVGGTPHVPLNFIAPGGSQHGPFTGIACGK
SVMSSVSLMGGRSGVPLYDRNHVTGASSSSSSSTKATLYPPILNPPPSPATDPSLYNMDM
FYSSNIPATARPYRPYIIRGMAPPTTPCSTDVCDSDYSASRWKASKYYLDLNSDSDPYPP
PPTPHSQYLSAEDSCPPSPATERSYFHLFPPPPSPCTDSS
Download sequence
Identical sequences A0A2K5S631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]