SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5UEA6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5UEA6
Domain Number 1 Region: 10-207
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 2.22e-44
Family Isochorismatase-like hydrolases 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5UEA6
Sequence length 221
Comment (tr|A0A2K5UEA6|A0A2K5UEA6_MACFA) Isochorismatase domain-containing protein 2 {ECO:0000313|Ensembl:ENSMFAP00000010703} OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=ISOC2 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MAAARPILGRVLPGSSILFLCDMQEKFRHNIAYFPQIVSVAARMLRVARLLEVPVLLTEQ
YPQGLGPTVPELGAEGLQPLTKTCFSMVPALQQELDSRPQLRSVLLCGIEAQACILDPCS
YPGLALTSLYPQNTTLDLLDRGLQVHVVVDACSSRSQVDRLVALARMRQSGAFLSTSEGL
ILQLVGDAAHPQFKEIQKLIKEPAPDSGLLGLFQGQNPLLH
Download sequence
Identical sequences A0A2K5UEA6 A0A2K6A1P5
XP_011852356.1.47321 ENSMMUP00000016681 ENSMMUP00000016681 9544.ENSMMUP00000016681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]