SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2K5VCH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5VCH2
Domain Number 1 Region: 628-883
Classification Level Classification E-value
Superfamily YWTD domain 1.1e-56
Family YWTD domain 0.00000308
Further Details:      
 
Domain Number 2 Region: 17-276
Classification Level Classification E-value
Superfamily YWTD domain 9.81e-54
Family YWTD domain 0.00000136
Further Details:      
 
Domain Number 3 Region: 327-573
Classification Level Classification E-value
Superfamily YWTD domain 1.15e-49
Family YWTD domain 0.00000336
Further Details:      
 
Domain Number 4 Region: 931-1190
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-39
Family YWTD domain 0.0000396
Further Details:      
 
Domain Number 5 Region: 885-932
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000898
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1321-1359
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000668
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 7 Region: 583-630
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000012
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 8 Region: 1242-1282
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000128
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 1283-1319
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 10 Region: 279-321
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000718
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 11 Region: 1200-1253
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000032
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K5VCH2
Sequence length 1609
Comment (tr|A0A2K5VCH2|A0A2K5VCH2_MACFA) LDL receptor related protein 6 {ECO:0000313|Ensembl:ENSMFAP00000022409} OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=LRP6 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
PGAVVGACSPSYSGAAPLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVFGHGL
IYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNL
DGSLRKVLFWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFIIINSEIYWP
NGLTLDYEEQKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDILYWTDWST
HSILACNKYTGEGLREIHSNIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMSPVKP
FYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIRHAIA
IDYDPVEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGT
DRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRVVL
VNTSLGWPNGLALDYDEGKIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTLLGDY
VYWTDWQRRSIERVHKRSAEREVIIDQLPDLMGLKATNVHRVIGSNPCAEENGGCSHLCL
YRPQGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEA
SALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADT
GTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERT
TLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQYQDY
IYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQSGWNECASSNGHCSHLC
LAVPVGGFVCGCPAHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILPIHSL
RNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPSQNLEIQPYDLSIDIY
SRYIYWTCEATNVINVTRLDGRSIGVVLKGEQDRPRAIVVNPEKGYMYFTNLQERSPKIE
RAALDGTEREVLFFSGLSKPIALALDSRLGKLFWADSDLRRIESSDLSGANRIVLEDSNI
LQPVGLTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQEYRQ
HPCAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCI
PVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEKNCEV
LCLIDQFRCANGQCIGKHKKCDHNVDCSDKSDELDCYPTEEPAPQATNTVGSVIGVIVTI
FVSGTIYFICQRMLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKS
MISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTMEFGY
SSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVATAKGYTSDLNYDS
EPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences A0A2K5VCH2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]