SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2K5VSE1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5VSE1
Domain Number 1 Region: 101-328
Classification Level Classification E-value
Superfamily L domain-like 1.21e-45
Family Ngr ectodomain-like 0.032
Further Details:      
 
Domain Number 2 Region: 356-660
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 8.61e-43
Family Rhodopsin-like 0.00051
Further Details:      
 
Domain Number 3 Region: 26-63
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000183
Family LDL receptor-like module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K5VSE1
Sequence length 709
Comment (tr|A0A2K5VSE1|A0A2K5VSE1_MACFA) Relaxin/insulin like family peptide receptor 1 {ECO:0000313|Ensembl:ENSMFAP00000027698} OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=RXFP1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MTSGPVFFYILIIGKYFSHGGGQDVKCSLGYFPCGNITKCLPQLLHCNGVDDCGNQADED
NCGDNNGWSLQFDKYFASYSKMTSPYPFEAETPECLVSSVPVQCLCQGLELDCDETNLRA
VPSVSSNVTAMSLQWNLIRKLPPDCFKNYHDLQKLYLQNNKITSISIYAFRGLNSLTKLY
LSHNRITFLKPGVFEDLHRLEWLIIEDNHLSRISPPTFYGLNSLILLVLMNNVLTRLPDK
PLCQHMPRLHWLDLEGNHIHNLRNLTFISCSNLTVLVMRKNKINYLNENTFAPLQKLDEF
SLEGIEISNIQQRMFRPLMNLSHIYFKKFQYCGYAPHVRSCKPNTDGISSLENLLASIIQ
RVFVWVVSAVTCFGNIFVICMRPYIRSENKLYAMSIISLCCADCLMGIYLFVIGGFDLKF
RGEYNKHAQLWMESTHCQLVGSLAILSTEVSVLLLTFLTLEKYICIVYPFRCVRPGKCRT
ITVLILIWITGFIVAFIPLSNKEFFKNYYGTNGVCFPLHSEDTESIGAQIYSVAIFLGIN
LAAFIIIVFSYGSMFYSVHQSAITATEIQNRVKKEMILAKRFFFIVFTDALCWIPIFVVK
FLSLLQVEIPGTITSWVVIFILPINSALNPILYTLTTRPFKEMIHQFWYNYRQRRSMDSK
GQKTYAPSFIWVEMWPLQEMPPELMKPDLFTYPCEMSLISQSTRLNSYS
Download sequence
Identical sequences A0A2K5VSE1 A0A2K6CPS3 F6T6T5
ENSMMUP00000006182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]