SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2K5XM44 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5XM44
Domain Number 1 Region: 619-874
Classification Level Classification E-value
Superfamily YWTD domain 1.09e-56
Family YWTD domain 0.00000308
Further Details:      
 
Domain Number 2 Region: 8-267
Classification Level Classification E-value
Superfamily YWTD domain 8.24e-54
Family YWTD domain 0.00000136
Further Details:      
 
Domain Number 3 Region: 318-564
Classification Level Classification E-value
Superfamily YWTD domain 1.12e-49
Family YWTD domain 0.00000336
Further Details:      
 
Domain Number 4 Region: 922-1181
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-39
Family YWTD domain 0.0000396
Further Details:      
 
Domain Number 5 Region: 876-923
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000898
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 574-621
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000115
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 7 Region: 1234-1273
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 8 Region: 1308-1345
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000445
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 9 Region: 1274-1309
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000537
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 10 Region: 270-312
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000773
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 11 Region: 1191-1244
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000315
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K5XM44
Sequence length 1595
Comment (tr|A0A2K5XM44|A0A2K5XM44_MANLE) LDL receptor related protein 6 {ECO:0000313|Ensembl:ENSMLEP00000004379} KW=Complete proteome OX=9568 OS=Mandrillus leucophaeus (Drill) (Papio leucophaeus). GN=LRP6 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Mandrillus.
Sequence
SFFVLAAPLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVFGHGLIYWSDVSEE
AIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVLF
WQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFIIINSEIYWPNGLTLDYEE
QKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDILYWTDWSTHSILACNKY
TGEGLREIHSNIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMSPVKPFYQCACPTG
VKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIRHAIAIDYDPVEGY
IYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLN
GTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRVVLVNTSLGWPN
GLALDYDEGKIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTLLGDYVYWTDWQRR
SIERVHKRSAEREVIIDQLPDLMGLKATNVHRVIGSNPCAEENGGCSHLCLYRPQGLRCA
CPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTD
NRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSK
LDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRA
NGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQYQDYIYWTDWSRR
SIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQSGWNECASSNGHCSHLCLAVPVGGFV
CGCPAHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDYD
PLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPSQNLEIQPYDLSIDIYSRYIYWTCE
ATNVINVTRLDGRSIGVVLKGEQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTER
EVLFFSGLSKPIALALDSRLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVF
ENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQEYRQHPCAQDNGG
CSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGF
TECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEKNCEESQFQCASGQ
CIDGALRCNGDANCQDKSDEKNYPTEEPAPQATNTVGSVIGVIVTIFVSGTIYFICQRML
CPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSMISSLSIMGGSSGP
PYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTMEFGYSSNSPSTHRSYSYR
PYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVATAKGYTSDLNYDSEPVPPPPTPRSQYL
SAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences A0A2K5XM44

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]