SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5XY36 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5XY36
Domain Number 1 Region: 6-153
Classification Level Classification E-value
Superfamily L domain-like 8.5e-29
Family U2A'-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K5XY36
Sequence length 249
Comment (tr|A0A2K5XY36|A0A2K5XY36_MANLE) Acidic nuclear phosphoprotein 32 family member A {ECO:0000313|Ensembl:ENSMLEP00000008185} KW=Complete proteome OX=9568 OS=Mandrillus leucophaeus (Drill) (Papio leucophaeus). GN=ANP32A OC=Catarrhini; Cercopithecidae; Cercopithecinae; Mandrillus.
Sequence
MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANL
PKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDL
FNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYD
EDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRKRE
PEDEGEDDD
Download sequence
Identical sequences A0A096NMH2 A0A2J8UCC9 A0A2K5D878 A0A2K5JVM6 A0A2K5LPR4 A0A2K5PJL0 A0A2K5XY36 A0A2K6DXD7 A0A2K6L0X4 A0A2K6P0Z5 F6Y529 G1RSJ4 G7MY28 I7GHD6 K7BJB7 P39687
ENSNLEP00000016217 ENSCJAP00000004254 ENSNLEP00000016217 9606.ENSP00000417864 ENSP00000417864 ENSPANP00000014181 gi|5453880|ref|NP_006296.1| ENSP00000417864 ENSP00000386496 NP_001247747.1.72884 NP_006296.1.87134 NP_006296.1.92137 XP_002753320.1.60252 XP_002825645.1.23681 XP_003267197.1.23891 XP_003954569.2.37143 XP_005559967.1.63531 XP_008014290.1.81039 XP_010361939.1.97406 XP_011749898.1.29376 XP_011795719.1.43180 XP_011824195.1.47321 XP_011948013.1.92194 XP_012306772.1.9421 XP_017369073.1.71028 XP_017706634.1.44346 ENSCJAP00000004246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]