SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2K5Z0H9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5Z0H9
Domain Number 1 Region: 538-668
Classification Level Classification E-value
Superfamily PH domain-like 2.74e-38
Family Pleckstrin-homology domain (PH domain) 0.0031
Further Details:      
 
Domain Number 2 Region: 5-80
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.37e-19
Family SAM (sterile alpha motif) domain 0.0032
Further Details:      
 
Domain Number 3 Region: 201-300
Classification Level Classification E-value
Superfamily PDZ domain-like 5.13e-17
Family PDZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K5Z0H9
Sequence length 898
Comment (tr|A0A2K5Z0H9|A0A2K5Z0H9_MANLE) Uncharacterized protein {ECO:0000313|Ensembl:ENSMLEP00000021305} KW=Complete proteome OX=9568 OS=Mandrillus leucophaeus (Drill) (Papio leucophaeus). GN= OC=Catarrhini; Cercopithecidae; Cercopithecinae; Mandrillus.
Sequence
MALIMEPVSKWSPSQVVDWMKGLDDCLQQYIKNFEREKISGDQLLRITHQELEDLGVSRI
GHQELILEAVDLLCALNYGLETENLKTLSHKLNASAKNLQNFITGRRRSGHYDGRTSRKL
PNDFLTSVVDLIGAAKSLLAWLDRSPFAAVTDYSVTRNNVIQLCLELTTIVQQDCTVYET
ENKILHVCKTLSGVCDHIISLSSDPLVSQSAHLEVIQLANIKPSEGLGMYIKSTYDGLHV
ITGTTENSPADRCKKIHAGDEVIQVNHQTVVGWQLKNLVNALREDPSGVILTLKKRPQSM
LTSAPALLKNMRWKPLALQPLIPRSPTSSVATPSSTISTPTKRDSSALQDLYIPPPPAEP
YIPRDEKGNLPCEDLRGHMVGKPVHKGSESPNSFLDQEYRKRFNIVEEDTVLYCYEYEKG
RSSSQGRRESTPTYGKLRPISMPVEYNWVGDYEDPNKMKRDSRRENSLLRYMSNEKIAQE
EYMFQRNSKKDTGKKSKKKGDKSNSPTHYSLLPSLQMDALRQDIMGTPVPETTLYHTFQQ
SSLQHKSKKKNKGPIAGKSKRRISCKDLGRGDCEGWLWKKKDAKSYFSQKWKKYWFVLKD
ASLYWYINEEDEKAEGFISLPEFKIDRASECRKKYAFKACHPKIKSFYFAAEHLDDMNRW
LNRINMLTAGYAERERIKQEQDYWSESDKEEADTPSTPKQDSPPPPYDTYPRPPSMSCAS
PYVEAKHSRLSSTETSQSQSSHEEFRQEVTGSSAVSPIRKTASQRRSWQDLIETPLTSSG
LHYLQTLPLEDSVFSDSAAISPEHRRQSTLPTQKCHLQDHYGPYPLAESERMQVLNGNGG
KPRSFTLPRDSGFNHCCLNAPVSACDPQDDVQPPEVEEEEEEEEEEGEAAGENIGEKS
Download sequence
Identical sequences A0A2I3LKJ7 A0A2J8W416 A0A2K5MEG7 A0A2K5WKI3 A0A2K5Z0H9 A0A2K6C580 F7B538 G3RD43
NP_001162119.1.87134 NP_001162119.1.92137 XP_001086429.1.72884 XP_005593213.1.63531 XP_007989464.1.81039 XP_011843421.1.47321 ENSP00000279451 ENSMMUP00000041173 gi|281306727|ref|NP_001162119.1| ENSP00000279451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]