SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5Z5A0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5Z5A0
Domain Number 1 Region: 160-325
Classification Level Classification E-value
Superfamily PH domain-like 7.11e-49
Family Phosphotyrosine-binding domain (PTB) 0.0019
Further Details:      
 
Domain Number 2 Region: 3-72
Classification Level Classification E-value
Superfamily SAM/Pointed domain 9.82e-19
Family SAM (sterile alpha motif) domain 0.0069
Further Details:      
 
Domain Number 3 Region: 75-138
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.39e-16
Family SAM (sterile alpha motif) domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K5Z5A0
Sequence length 394
Comment (tr|A0A2K5Z5A0|A0A2K5Z5A0_MANLE) Ankyrin repeat and sterile alpha motif domain containing 1B {ECO:0000313|Ensembl:ENSMLEP00000022920} KW=Complete proteome OX=9568 OS=Mandrillus leucophaeus (Drill) (Papio leucophaeus). GN=ANKS1B OC=Catarrhini; Cercopithecidae; Cercopithecinae; Mandrillus.
Sequence
MGPRCPVQTVGQWLESIGLPQYENHLMANGFDNVQFMGSNVMEDQDLLEIGILNSGHRQR
ILQAIQLLPKMRPIGHDGYHPTSVAEWLDSIELGDYTKAFLINGYTSMDLLKKIWEVELI
NVLKINLIGHRKRILASLGDRLHDDPPQKPPRSITLRTGDWGEPSITLRPPNEATASTPV
QYWQHHPEKLIFQSCDYKAFYLGSMLIKELRGTESTQDACAKMRANCQKSTEQMKKVPTI
ILSVSYKGVKFIDATNKNIIAEHEIRNISCAAQDPEDLSTFAYITKDLKSNHHYCHVFTA
FDVNLAYEIILTLGQAFEVAYQLALQARKGGHSSTLPESFENKPSKPIPKPRVSIRKSVI
DPSEQKTLANLPWIVEPGQEAKRGINTKYETTIF
Download sequence
Identical sequences A0A1D5QTH4 A0A287DEF4 A0A2I2ZHX0 A0A2I3GTU5 A0A2I3LKJ6 A0A2I3SCZ8 A0A2J8XMN2 A0A2K5HG75 A0A2K5MA63 A0A2K5V4V2 A0A2K5Z5A0 A0A2K6E9D3 A0A2K6RE44
NP_001190996.1.87134 NP_001190996.1.92137 XP_004381322.1.4749 XP_004403926.1.74151 XP_005322445.1.77405 XP_006876006.1.41390 XP_007945384.1.48129 XP_009424345.1.37143 XP_010354247.1.97406 XP_010597865.1.64505 XP_011708721.1.29376 XP_011789917.1.43180 XP_011847625.1.47321 XP_011888166.1.92194 XP_012355590.1.23891 XP_015338381.1.40921 ENSP00000450015 ENSP00000450015 gi|323276632|ref|NP_001190996.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]