SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2K6CPG2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6CPG2
Domain Number 1 Region: 561-769
Classification Level Classification E-value
Superfamily RNI-like 4.71e-17
Family 28-residue LRR 0.02
Further Details:      
 
Domain Number 2 Region: 77-162
Classification Level Classification E-value
Superfamily PH domain-like 0.0000117
Family Pleckstrin-homology domain (PH domain) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K6CPG2
Sequence length 773
Comment (tr|A0A2K6CPG2|A0A2K6CPG2_MACNE) C-Maf inducing protein {ECO:0000313|Ensembl:ENSMNEP00000025591} KW=Complete proteome OX=9545 OS=Macaca nemestrina (Pig-tailed macaque). GN=CMIP OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MDVTSSSGGGGDPRQIEETKPLLGGDVSAPEGTKMGAVPCRRALLLCNGMRYKLLQEGDI
QVCVIRHPRTFLSKILTSKFLRRWEPHHLTLADNSLASATPTGYMENSVSYSAIEDVQLL
SWENAPKYCLQLTIPGGTVLLQAANSYLRDQWFHSLQWKKKIYKYKKVLSNPSRWEVVLK
EIRTLVDMALTSPLQDDSINQAPLEIVSKLLSENTNLTTQEHENIIVAIAPLLENNHPPP
DLCEFFCKHCRERPRSMVVIEVFTPVVQRILKHNMDFGKCPRLRLFTQEYILALNELNAG
MEVVKKFIQSMHGPTGHCPHPRVLPNLVAVCLAAIYSCYEEFINSRDNSPSLKEIRNGCQ
QPCDRKPTLPLRLLHPSPDLVSQEATLSEARLKSVVVASSEIHVEVERTSTAKPALTASA
GNDSEPNLIDCLMVSPACSTMSIELGPQADRTLGCYVEILKLLSDYDDWRPSLASLLQPI
PFPKEALAHEKFTKELKYVIQRFAEDPRQEVHSCLLSVRAGKDGWFQLYSPGGVACDDDG
ELFASMVHILMGSCYKTKKFLLSLAENKLGPCMLLALRGNQTMVEILCLMLEYNIIDNND
TQLQIISTLESTDVGKRMYEQLCDRQRELKELQRKGGPTRLTLPSKSTDADLARLLSSGS
FGNLENLSLAFTNVTSACAEHLIKLPSLKQLNLWSTQFGDAGLRLLSEHLTMLQVLNLCE
TPVTDAGLLALSSMKSLCSLNMNSTKLSADTYEDLKAKLPNLKEVDVRYTEAW
Download sequence
Identical sequences A0A2I3M4C3 A0A2K5KUY6 A0A2K5WR00 A0A2K6CPG2 A0A2K6MZQ3 A0A2K6PYR9 H9ZDW6 K7B6Q6 Q8IY22 U3CX54
ENSP00000446100 ENSP00000446100 ENSP00000446100 NP_938204.2.87134 NP_938204.2.92137 XP_005592690.1.63531 XP_010373448.1.97406 XP_011755695.1.29376 XP_011942805.1.92194 XP_014982179.1.72884 XP_017397351.1.71028 XP_017743684.1.44346 XP_017822297.1.60252 XP_511233.4.37143 gi|194018550|ref|NP_938204.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]