SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2K6DW18 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6DW18
Domain Number 1 Region: 58-251
Classification Level Classification E-value
Superfamily Sec7 domain 1.13e-78
Family Sec7 domain 0.00000000469
Further Details:      
 
Domain Number 2 Region: 260-375
Classification Level Classification E-value
Superfamily PH domain-like 2.2e-34
Family Pleckstrin-homology domain (PH domain) 0.000000663
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K6DW18
Sequence length 400
Comment (tr|A0A2K6DW18|A0A2K6DW18_MACNE) Cytohesin 2 {ECO:0000313|Ensembl:ENSMNEP00000040097} KW=Complete proteome OX=9545 OS=Macaca nemestrina (Pig-tailed macaque). GN=CYTH2 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MEDGVYEPPDLTPEERMELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGSKTLQ
RNRKMAMGRKKFNMDPKKGIQFLVENELLQNTPEEIARFLYKGEGLNKTAIGDYLGEREE
LNLAVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQ
STDTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNRGINEGGDLPEELLRNLYDSIRN
EPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEP
RGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPT
QEEKDEWIKSIQAAVSVDPFYEMLAARKKRISVKKKQEQP
Download sequence
Identical sequences A0A0A0MUM8 A0A1S3AKC2 A0A2I2ZX70 A0A2K5L818 A0A2K5VG08 A0A2K5YTI3 A0A2K6DW18 A0A2K6K5S4 A0A2K6RV97 G1QWZ6 H9ENF6 K7DCH1 Q99418
NP_001247820.1.72884 NP_059431.1.87134 NP_059431.1.92137 XP_004381747.1.4749 XP_007536292.1.11023 XP_021589822.1.77405 gi|8670546|ref|NP_059431.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]