SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2K6E416 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6E416
Domain Number 1 Region: 625-880
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-55
Family YWTD domain 0.00000599
Further Details:      
 
Domain Number 2 Region: 324-554
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-51
Family YWTD domain 0.00000282
Further Details:      
 
Domain Number 3 Region: 24-240
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-44
Family YWTD domain 0.00000381
Further Details:      
 
Domain Number 4 Region: 927-1184
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-37
Family YWTD domain 0.0000686
Further Details:      
 
Domain Number 5 Region: 1315-1351
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000707
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1277-1313
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000445
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1237-1275
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000576
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 8 Region: 580-626
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000186
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 9 Region: 279-321
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000661
Family EGF-type module 0.01
Further Details:      
 
Domain Number 10 Region: 883-930
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000921
Family EGF-type module 0.02
Further Details:      
 
Domain Number 11 Region: 1194-1246
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000884
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K6E416
Sequence length 1595
Comment (tr|A0A2K6E416|A0A2K6E416_MACNE) LDL receptor related protein 5 {ECO:0000313|Ensembl:ENSMNEP00000042922} KW=Complete proteome OX=9545 OS=Macaca nemestrina (Pig-tailed macaque). GN=LRP5 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MSGAVPGVLWPVALTVCFCPTASPLLLFANRRDVRLVDAGGVKLESTIVVSGLEDAAAVD
FQFSKGAVYWTDVSEEAIKQTYLNQTGAAVQNVVISGLVSPDGLACDWVGKKLYWTDSET
NRIEVANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDGSTRKII
VDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSRGH
SVLDGLQTRSIMPCNNALVLPMDIQVLSQERQPFFHTRCEEDNGGCSHLCLLSPREPFYT
CACPTGVQLQDNGRTCKAGAEEVLLLARRTDLRRISLDTPDFTDIVLQVDDIRHAIAIDY
DPLEGYVYWTDDEVRAIRRAYLDGSGAQTLVNTEINDPDGIAVDWVARNLYWTDTGTDRI
EVTRLNGTSRKILVSEDLDEPRAIALHPVMGLMYWTDWGENPKIECANLDGQERRVLVNA
SLGWPNGLALDLQEGKLYWGDAKTDKIEVINVDGTKRRTLLEDKLPHIFGFTLLGDFIYW
TDWQRRSIERVHKVKASRDVIIDQLPDLMGLKAVNVAKVVGTNPCADRNGGCSHLCFFTP
HATRCGCPIGLELLSDMKTCIVPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVKEASAL
DFDVSNNHIYWTDVSLKTISRAFMNGSSVEHVVEFGLDYPEGMAVDWMGKNLYWADTGTN
RIEVARLDGQFRQVLVWRDLDNPRSLALDPTKGYIYWTEWGGKPRIVRAFMDGTNCMTLV
DKVGRANDLTIDYADQRLYWTDLDTNMIESSNMLGQERVVIADDLPHPFGLTQYSDYIYW
TDWNLHSIERADKTSGRNRTLIQGHLDFVMDILVFHSSRQDGLNDCMHNNGQCGQLCLAI
PGGHRCGCASHHTLDPSSRNCSPPTTFLLFSQKSAISRMIPDDQHSPDLILPLHGLRNVK
AIDYDPLDKFIYWVDGRQNIKRAKDDGTQPFVLTSMSQGQNPDRQPHDLSIDIYSRTLFW
TCEATNTINVHRLSGEAMGVVLRGDRDKPRAIVVNAERGYLYFTNMQDRAAKIERAALDG
TEREVLFTTGLIRPVALVVDNTLGKLFWVDADLKRIESCDLSGANRLTLEDANIVQPLGL
TVLGKHLYWIDRQQQMIERVEKTTGDKRTRVQGRVAHLTGIHAVEEVSLEEFSAHPCARD
NGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQFACATGEIDCIPGAWRC
DGFPECDDQSDEEGCPVCSAAQFPCARGQCVDLRLRCDGEADCQDRSDEADCDAICLPNQ
FRCASGQCVLIKQQCDSFPDCIDGSDELMCEITKPPSDDSPAHSSAIGPVIGIILSLFVM
GGVYFVCQRVVCQRYAGANGPFPHEYVSGTPHVPLNFIAPGGSQHGPFTGIACGKSMMSS
VSLMGGRGGVPLYDRNHVTGASSSSSSSTKATLYPPILNPPPSPATDPSLYNMDMFYSSN
IPATARPYRPYIIRGMAPPTTPCSTDVCDSDYSASRWKASKYYLDLNSDSDPYPPPPTPH
SQYLSAEDSCPPSPATERSYFHLFPPPPSPCTDSS
Download sequence
Identical sequences A0A2K6E416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]