SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2K6E418 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6E418
Domain Number 1 Region: 621-876
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-55
Family YWTD domain 0.00000599
Further Details:      
 
Domain Number 2 Region: 320-550
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-51
Family YWTD domain 0.00000282
Further Details:      
 
Domain Number 3 Region: 20-236
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-44
Family YWTD domain 0.00000381
Further Details:      
 
Domain Number 4 Region: 923-1180
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-37
Family YWTD domain 0.0000686
Further Details:      
 
Domain Number 5 Region: 1311-1347
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000707
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1273-1309
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000445
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1233-1271
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000563
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 8 Region: 576-622
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000197
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 9 Region: 275-317
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000661
Family EGF-type module 0.01
Further Details:      
 
Domain Number 10 Region: 879-926
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000921
Family EGF-type module 0.02
Further Details:      
 
Domain Number 11 Region: 1190-1242
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000936
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K6E418
Sequence length 1591
Comment (tr|A0A2K6E418|A0A2K6E418_MACNE) LDL receptor related protein 5 {ECO:0000313|Ensembl:ENSMNEP00000042915} KW=Complete proteome OX=9545 OS=Macaca nemestrina (Pig-tailed macaque). GN=LRP5 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
PPWPPKPVALTVCFCPTASPLLLFANRRDVRLVDAGGVKLESTIVVSGLEDAAAVDFQFS
KGAVYWTDVSEEAIKQTYLNQTGAAVQNVVISGLVSPDGLACDWVGKKLYWTDSETNRIE
VANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDGSTRKIIVDSD
IYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSRGHSVLD
GLQTRSIMPCNNALVLPMDIQVLSQERQPFFHTRCEEDNGGCSHLCLLSPREPFYTCACP
TGVQLQDNGRTCKAGAEEVLLLARRTDLRRISLDTPDFTDIVLQVDDIRHAIAIDYDPLE
GYVYWTDDEVRAIRRAYLDGSGAQTLVNTEINDPDGIAVDWVARNLYWTDTGTDRIEVTR
LNGTSRKILVSEDLDEPRAIALHPVMGLMYWTDWGENPKIECANLDGQERRVLVNASLGW
PNGLALDLQEGKLYWGDAKTDKIEVINVDGTKRRTLLEDKLPHIFGFTLLGDFIYWTDWQ
RRSIERVHKVKASRDVIIDQLPDLMGLKAVNVAKVVGTNPCADRNGGCSHLCFFTPHATR
CGCPIGLELLSDMKTCIVPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVKEASALDFDV
SNNHIYWTDVSLKTISRAFMNGSSVEHVVEFGLDYPEGMAVDWMGKNLYWADTGTNRIEV
ARLDGQFRQVLVWRDLDNPRSLALDPTKGYIYWTEWGGKPRIVRAFMDGTNCMTLVDKVG
RANDLTIDYADQRLYWTDLDTNMIESSNMLGQERVVIADDLPHPFGLTQYSDYIYWTDWN
LHSIERADKTSGRNRTLIQGHLDFVMDILVFHSSRQDGLNDCMHNNGQCGQLCLAIPGGH
RCGCASHHTLDPSSRNCSPPTTFLLFSQKSAISRMIPDDQHSPDLILPLHGLRNVKAIDY
DPLDKFIYWVDGRQNIKRAKDDGTQPFVLTSMSQGQNPDRQPHDLSIDIYSRTLFWTCEA
TNTINVHRLSGEAMGVVLRGDRDKPRAIVVNAERGYLYFTNMQDRAAKIERAALDGTERE
VLFTTGLIRPVALVVDNTLGKLFWVDADLKRIESCDLSGANRLTLEDANIVQPLGLTVLG
KHLYWIDRQQQMIERVEKTTGDKRTRVQGRVAHLTGIHAVEEVSLEEFSAHPCARDNGGC
SHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQFACATGEIDCIPGAWRCDGFP
ECDDQSDEEGCPVCSAAQFPCARGQCVDLRLRCDGEADCQDRSDEADCDAICLPNQFRCA
SGQCVLIKQQCDSFPDCIDGSDELMCEITKPPSDDSPAHSSAIGPVIGIILSLFVMGGVY
FVCQRVVCQRYAGANGPFPHEYVSGTPHVPLNFIAPGGSQHGPFTGIACGKSMMSSVSLM
GGRGGVPLYDRNHVTGASSSSSSSTKATLYPPILNPPPSPATDPSLYNMDMFYSSNIPAT
ARPYRPYIIRGMAPPTTPCSTDVCDSDYSASRWKASKYYLDLNSDSDPYPPPPTPHSQYL
SAEDSCPPSPATERSYFHLFPPPPSPCTDSS
Download sequence
Identical sequences A0A2K6E418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]