SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2K6E455 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6E455
Domain Number 1 Region: 629-884
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-55
Family YWTD domain 0.00000599
Further Details:      
 
Domain Number 2 Region: 328-558
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-51
Family YWTD domain 0.00000282
Further Details:      
 
Domain Number 3 Region: 28-244
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-44
Family YWTD domain 0.00000381
Further Details:      
 
Domain Number 4 Region: 931-1188
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-37
Family YWTD domain 0.0000686
Further Details:      
 
Domain Number 5 Region: 1319-1355
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000707
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1281-1317
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000445
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1241-1279
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000576
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 8 Region: 584-630
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000191
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 9 Region: 887-934
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000132
Family EGF-type module 0.02
Further Details:      
 
Domain Number 10 Region: 283-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000849
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1198-1250
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000931
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K6E455
Sequence length 1599
Comment (tr|A0A2K6E455|A0A2K6E455_MACNE) LDL receptor related protein 5 {ECO:0000313|Ensembl:ENSMNEP00000042919} KW=Complete proteome OX=9545 OS=Macaca nemestrina (Pig-tailed macaque). GN=LRP5 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MSGAVPGCCIPGLCPVALTVCFCPTASPLLLFANRRDVRLVDAGGVKLESTIVVSGLEDA
AAVDFQFSKGAVYWTDVSEEAIKQTYLNQTGAAVQNVVISGLVSPDGLACDWVGKKLYWT
DSETNRIEVANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDGST
RKIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTL
SRGHSVLDGLQTRSIMPCNNALVLPMDIQVLSQERQPFFHTRCEEDNGGCSHLCLLSPRE
PFYTCACPTGVQLQDNGRTCKAGAEEVLLLARRTDLRRISLDTPDFTDIVLQVDDIRHAI
AIDYDPLEGYVYWTDDEVRAIRRAYLDGSGAQTLVNTEINDPDGIAVDWVARNLYWTDTG
TDRIEVTRLNGTSRKILVSEDLDEPRAIALHPVMGLMYWTDWGENPKIECANLDGQERRV
LVNASLGWPNGLALDLQEGKLYWGDAKTDKIEVINVDGTKRRTLLEDKLPHIFGFTLLGD
FIYWTDWQRRSIERVHKVKASRDVIIDQLPDLMGLKAVNVAKVVGTNPCADRNGGCSHLC
FFTPHATRCGCPIGLELLSDMKTCIVPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVKE
ASALDFDVSNNHIYWTDVSLKTISRAFMNGSSVEHVVEFGLDYPEGMAVDWMGKNLYWAD
TGTNRIEVARLDGQFRQVLVWRDLDNPRSLALDPTKGYIYWTEWGGKPRIVRAFMDGTNC
MTLVDKVGRANDLTIDYADQRLYWTDLDTNMIESSNMLGQERVVIADDLPHPFGLTQYSD
YIYWTDWNLHSIERADKTSGRNRTLIQGHLDFVMDILVFHSSRQDGLNDCMHNNGQCGQL
CLAIPGGHRCGCASHHTLDPSSRNCSPPTTFLLFSQKSAISRMIPDDQHSPDLILPLHGL
RNVKAIDYDPLDKFIYWVDGRQNIKRAKDDGTQPFVLTSMSQGQNPDRQPHDLSIDIYSR
TLFWTCEATNTINVHRLSGEAMGVVLRGDRDKPRAIVVNAERGYLYFTNMQDRAAKIERA
ALDGTEREVLFTTGLIRPVALVVDNTLGKLFWVDADLKRIESCDLSGANRLTLEDANIVQ
PLGLTVLGKHLYWIDRQQQMIERVEKTTGDKRTRVQGRVAHLTGIHAVEEVSLEEFSAHP
CARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQFACATGEIDCIPG
AWRCDGFPECDDQSDEEGCPVCSAAQFPCARGQCVDLRLRCDGEADCQDRSDEADCDAIC
LPNQFRCASGQCVLIKQQCDSFPDCIDGSDELMCEITKPPSDDSPAHSSAIGPVIGIILS
LFVMGGVYFVCQRVVCQRYAGANGPFPHEYVSGTPHVPLNFIAPGGSQHGPFTGIACGKS
MMSSVSLMGGRGGVPLYDRNHVTGASSSSSSSTKATLYPPILNPPPSPATDPSLYNMDMF
YSSNIPATARPYRPYIIRGMAPPTTPCSTDVCDSDYSASRWKASKYYLDLNSDSDPYPPP
PTPHSQYLSAEDSCPPSPATERSYFHLFPPPPSPCTDSS
Download sequence
Identical sequences A0A2K6E455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]