SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2K6EUM9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6EUM9
Domain Number 1 Region: 839-968,1033-1099
Classification Level Classification E-value
Superfamily Hemopexin-like domain 6.07e-38
Family Hemopexin-like domain 0.00097
Further Details:      
 
Domain Number 2 Region: 68-107
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000628
Family Somatomedin B domain 0.0013
Further Details:      
 
Domain Number 3 Region: 26-66
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000144
Family Somatomedin B domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K6EUM9
Sequence length 1099
Comment (tr|A0A2K6EUM9|A0A2K6EUM9_PROCO) Uncharacterized protein {ECO:0000313|Ensembl:ENSPCOP00000005413} KW=Complete proteome OX=379532 OS=coquereli). GN= OC=Lemuriformes; Indriidae; Propithecus.
Sequence
MEWKILPIYLLLLSVFLIQQVSSQDLSSCAGRCGEGYSRDATCNCDYNCQHYMECCPDFK
RVCTVELSCKGRCFESFARGRECDCDSQCEKYGKCCSDYGDFCAEVHNPTSPPSSKTAPP
PPGARQNIKSTTKRSPKSPDKKKTKKVVESEEITEDNKKKTPKKKPTPETPAEDEAGSGP
DNGDFKLTPTPDIPTTQRNKVTTSPKITTAKPINPKSTLPPNSDTSEETSLTANKETTAK
TKETTVTNKQTSTSAKETTSAKETQSAEKTSAKDVAPTSEVPAKPASKAETTTKAPALTT
PKEPAPTTPKKPVSTTLKEQPPTTTKEPAPTTPKEQPPTTTKEPEPAPTTPKEQPPTTTK
EPAPTTAKEQPPTTPKESAPTTPKKPVPTTKDPEPPTPKESTPVTPKEPAPTTPKEPAPT
TIKEPTPTTPKKPISITPKDPVPTTTKEPSPTTPKEPAPTIPKEPAPTIPKDPAFTTPKE
PAPTTPKEPAPTTPKEPIPTTPKDPVPDTPKKPIPTTPKEPAPTTPKALAPTTPKEPAPT
TPETPAPTTSEASTSTTTMEPPTTPEIPPESTPEFSAGPTPKPPENSPKNPAVPTTKTPE
VTKPKMTTTAQDKTPEKDIHTVPEITTAVPKITTKETETTREETTESKTSTTTQLTSTTT
QDTASIKITTLKATTLAPKVTTATKKTTTTTETMKKPEETAKPKDTTTNSKATTPKPQKP
TKAPKKPTSTKKPRPTARVRKPKTTPTPPKMTTTMPELNPTSLAESRLQTATSPNQAPNS
EIVEVYPENEDADGAEGEKLHLIPRPPVLVPIVIPGIDYSVRGPNQGIVINPMLSDETNL
CNGKPVDGLTTLRNGTLVAFRGHYFWMLSPFSPPPPARRITEVWGIPSPIDTVFTRCNCE
GKTFFFKDSQYWRFTNDVKDAGYPKQIVKGFGGLNGKIVAALSIAKYKNRPESVYFFKRG
GSIQQYTYKQEPVSKCPGRRPAINYPVYGETTQVRRRRFERAIGPSQIHTIRIHYSPVRV
PYQDKGFLHNEVKVSTLWRGFPTMVTSAISLPNIRKPDGYDYYAFSKDQYYDIDVPSRTA
RAITTRSGQTLSKVWYNCP
Download sequence
Identical sequences A0A2K6EUM9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]