SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2K6F2C1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6F2C1
Domain Number 1 Region: 598-853
Classification Level Classification E-value
Superfamily YWTD domain 8.5e-57
Family YWTD domain 0.00000308
Further Details:      
 
Domain Number 2 Region: 14-273
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-54
Family YWTD domain 0.00000136
Further Details:      
 
Domain Number 3 Region: 901-1160
Classification Level Classification E-value
Superfamily YWTD domain 3.4e-39
Family YWTD domain 0.0000427
Further Details:      
 
Domain Number 4 Region: 324-509
Classification Level Classification E-value
Superfamily YWTD domain 5.89e-39
Family YWTD domain 0.00000982
Further Details:      
 
Domain Number 5 Region: 855-902
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000628
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1291-1329
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000981
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 7 Region: 1212-1252
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000126
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 8 Region: 553-600
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000136
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 9 Region: 1253-1289
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 10 Region: 276-318
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000718
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 11 Region: 1170-1223
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000311
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K6F2C1
Sequence length 1579
Comment (tr|A0A2K6F2C1|A0A2K6F2C1_PROCO) LDL receptor related protein 6 {ECO:0000313|Ensembl:ENSPCOP00000008127} KW=Complete proteome OX=379532 OS=coquereli). GN=LRP6 OC=Lemuriformes; Indriidae; Propithecus.
Sequence
FLLTYFSFFVSAAPLLLYANRRDLRLVDATNGRENATIVVGGLEDAAAVDFVFGHGLIYW
SDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGS
LRKVLFWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFIIINTEIYWPNGL
TLDYEERKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDTLYWTDWNTHSI
LACNKYTGEGLREIHSNIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMSPVKPFYQ
CACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIRHAIAIDY
DPVEGYIYWTDDEVKAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRI
EVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRVVLVNT
SLGWPNGLALDYDEGKIYWGDAKTDKIEVLLLIPHMSGIMQYLSFCDWLISLSTMSSRFI
DVVAYDKISFYLLGSNPCAEENGGCSHLCLYRPQGLRCACPIGFELISDMKTCIVPEAFL
LFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDISLKTISRAFMNGS
ALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALA
LDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNL
IESSNMLGLNREVIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLD
YVMDILVFHSSRQAGWNECASSNGHCSHLCLAVPVGGFVCGCPAHYSLNADNRTCSAPTT
FLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQE
DGSQGFTVVVSSVPNQNLEIQPYDLSIDIYSRYIYWTCEATNVINVTRLDGRSIGVVLKG
EQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSKPIALALDSRLG
KLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDKQQQMIEKIDMTG
QEGRTKVQARIAQLSDIHAVKELNLQEYRQHPCAQDNGGCSHICLVKGDGTTRCSCPMHL
VLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQ
CASGQCIDGALRCNGDANCQDKSDEKNCEVLCLIDQFRCANGQCIGKHKKCDHNVDCSDK
SDELDCYPTEEPAPQATNTVGSVIGVIVTIFVSGTIYFLCQRMLCPRMKGDGETMTNDYV
VHGPASVPLGYVPHPSSLSGSLPGMSRGKSVISSLSIMGGSSGPPYDRAHVTGASSSSSS
STKGTYFPAILNPPPSPATERSHYTMEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCST
DVCDSDYAPSRRMTSAATAKGYTSDLNYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTE
RSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences A0A2K6F2C1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]