SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2K6FJ71 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6FJ71
Domain Number 1 Region: 45-108
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 9.64e-24
Family Transcriptional factor domain 0.0027
Further Details:      
 
Weak hits

Sequence:  A0A2K6FJ71
Domain Number - Region: 2-36
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0204
Family Transcriptional factor domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K6FJ71
Sequence length 108
Comment (tr|A0A2K6FJ71|A0A2K6FJ71_PROCO) Uncharacterized protein {ECO:0000313|Ensembl:ENSPCOP00000014029} KW=Complete proteome OX=379532 OS=coquereli). GN= OC=Lemuriformes; Indriidae; Propithecus.
Sequence
MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWE
NVDSTAEPCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD
Download sequence
Identical sequences A0A0D9RL73 A0A250Y909 A0A2J8R2P3 A0A2K5CVN9 A0A2K5HIF7 A0A2K5P4M1 A0A2K5S9I4 A0A2K5WWJ7 A0A2K6FJ71 A0A2K6N1U0 A0A2K6QTU0 A9L8T4 B0VX71 B1MT29 B2KHV5 F2Z4X7 G1PSP3 G1R900 G3QZI9 H2QA65 H9EUX4 K9IGP0 L5KH64 Q5FVH1 Q9CQZ7
ENSNLEP00000009687 ENSSSCP00000008509 ENSMUSP00000044582 ENSCJAP00000021248 ENSPVAP00000000497 ENSCJAP00000021248 ENSMLUP00000014203 ENSMUSP00000044582 ENSRNOP00000024096 ENSGGOP00000008302 ENSPVAP00000000497 ENSMLUP00000014203 ENSPTRP00000012852 ENSGGOP00000008302 ENSPANP00000010659 ENSPTRP00000012852 ENSSSCP00000008509 ENSRNOP00000024096 ENSNLEP00000009687 NP_001014281.1.100692 NP_001014281.1.4139 NP_080177.1.92730 XP_001150299.1.37143 XP_001364724.1.35504 XP_002755763.1.60252 XP_003269145.1.23891 XP_003761979.1.9362 XP_003809436.1.60992 XP_004056900.1.27298 XP_005590773.1.63531 XP_006107262.1.53796 XP_006914108.1.64745 XP_007977821.1.81039 XP_008155905.1.99482 XP_008585523.1.73410 XP_008694902.1.72690 XP_010380168.1.97406 XP_011375028.1.92234 XP_011891271.1.92194 XP_012324159.1.9421 XP_012515036.1.63892 XP_017366332.1.71028 XP_017716226.1.44346 XP_019573652.1.88060 XP_020031908.1.5219 XP_020862238.1.61212 XP_021049980.1.100879 XP_021502241.1.76796 XP_021502277.1.76796 10090.ENSMUSP00000044582 10116.ENSRNOP00000024096 13616.ENSMODP00000020727 9598.ENSPTRP00000012852 9823.ENSSSCP00000008509 ENSMUSP00000044582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]