SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2K6GQM4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6GQM4
Domain Number 1 Region: 636-891
Classification Level Classification E-value
Superfamily YWTD domain 1.14e-55
Family YWTD domain 0.0000059
Further Details:      
 
Domain Number 2 Region: 24-284
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-54
Family YWTD domain 0.00000166
Further Details:      
 
Domain Number 3 Region: 335-565
Classification Level Classification E-value
Superfamily YWTD domain 1.15e-50
Family YWTD domain 0.00000251
Further Details:      
 
Domain Number 4 Region: 938-1193
Classification Level Classification E-value
Superfamily YWTD domain 5.49e-37
Family YWTD domain 0.0000641
Further Details:      
 
Domain Number 5 Region: 1326-1362
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000707
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1288-1324
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000445
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1248-1286
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000576
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 8 Region: 591-637
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000838
Family EGF-type module 0.011
Further Details:      
 
Domain Number 9 Region: 894-945
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000347
Family EGF-type module 0.02
Further Details:      
 
Domain Number 10 Region: 289-332
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000112
Family EGF-type module 0.013
Further Details:      
 
Domain Number 11 Region: 1205-1257
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000931
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K6GQM4
Sequence length 1603
Comment (tr|A0A2K6GQM4|A0A2K6GQM4_PROCO) LDL receptor related protein 5 {ECO:0000313|Ensembl:ENSPCOP00000028556} KW=Complete proteome OX=379532 OS=coquereli). GN=LRP5 OC=Lemuriformes; Indriidae; Propithecus.
Sequence
MGWEKCRPSWPRSSRFASAPTASPLLLFANRRDVRLVDAGGVKLESTIVVSGLEDAAAVD
FQFSKGAVYWTDVSEEAIKQTFLNQTGAAVQNVVISGLVSPDGLACDWVGKKLYWTDSET
NRIEVANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDGSTRKII
VDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGDT
LYWTDWQTRSIHACNKRTGEKRKEILSALYSPMDIQVLSQERQPSFHTQCEEDNGGCSHL
CLLSPREPFYACACPTGVQLQDNGKTCKAGAEEVLLLARRTDLRRISLDTPDFTDIVLQV
DDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDGSGAQTLVNTEINDPDGIAVDWVARN
LYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAIVLHPVMGLMYWTDWGENPKIECANL
DGQERHVLVNASLGWPNGLALDLQEGKLYWGDAKTDKIEVINVDGTKRRTLLEDKLPHIF
GFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQLPDLMGLKAVNVAKVVGTNPCAEGN
GGCSHLCFFTPRATRCGCPIGLELLSDMKTCIVPEAFLVFTSRAAIHRISLETNNNDVAI
PLTGVKEASALDFDVSNNHIYWTDVSLKTISRAFMNGSSVEHVIEFGLDYPEGMAVDWMG
KNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPRSLALDPTKGYIYWTEWGGKPRIVRA
FMDGTNCMTLVDKVGRANDLTIDYTDQRLYWTDLDTNMIESSNMLGQERVVIADDLPHPF
GLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQGHLDFVMDILVFHSSRQDGLNDCMHN
NGQCGQLCLAIPGGHRCGCASHYTLDPSSRNCSPPTTFLLFSQKCAISRMIPDDQHSPDL
ILPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRARDDGTQPFVLASPSQGQNPDRQPHDL
SIDIYSRTLFWTCEATNTINVHRLSGDAMGVVLRGDRDKPRAIVVNAERGYLYFTNMQDR
AAKIERAALDGTEREVLFTTGLIRPVALVVDNTLGKLFWVDADLKRIESCDLSGANRLTL
EDANIVQPVGLTVLGKHLYWIDRQQQMIERVEKTTGDKRTRVQGRVAHLTGIHGVEEVSL
EEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQFACATG
EIDCIPGAWRCDGFPECDDQSDEEGCPVCSAAQFPCARGQCVDLRLRCDGEADCQDRSDE
ADCDAICLPNQFRCASGQCVLIKQQCDSFPDCIDGSDELMCEITKPPSDDTPGHSSAIGP
VIGIILSLFVMGGVYFVCQRVVCQRYAGANGPFPHEYVSGTPHVPLNFITPGGSQHGPFP
GISCGKSMMSSVSLMGGRGGVPLYDRNHVTGASSSSSSSTKATLYPPILNPPPSPATDPS
LYNMDMFYSSNIPAAARPYRPYIIRGMAPPTTPCSTDVCDSDYSASRWKASKYYLDLNSD
SDPYPPPPTPHSQYLSAEDSCPPSPPPPPRPGWVRELPACPGH
Download sequence
Identical sequences A0A2K6GQM4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]