SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2K6GQP9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6GQP9
Domain Number 1 Region: 639-894
Classification Level Classification E-value
Superfamily YWTD domain 1.15e-55
Family YWTD domain 0.0000059
Further Details:      
 
Domain Number 2 Region: 27-287
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-54
Family YWTD domain 0.00000166
Further Details:      
 
Domain Number 3 Region: 338-568
Classification Level Classification E-value
Superfamily YWTD domain 1.16e-50
Family YWTD domain 0.00000251
Further Details:      
 
Domain Number 4 Region: 941-1196
Classification Level Classification E-value
Superfamily YWTD domain 5.49e-37
Family YWTD domain 0.0000641
Further Details:      
 
Domain Number 5 Region: 1329-1365
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000707
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1291-1327
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000445
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1251-1289
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000576
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 8 Region: 594-640
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000882
Family EGF-type module 0.011
Further Details:      
 
Domain Number 9 Region: 897-948
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000347
Family EGF-type module 0.02
Further Details:      
 
Domain Number 10 Region: 292-335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000112
Family EGF-type module 0.013
Further Details:      
 
Domain Number 11 Region: 1208-1260
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000931
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K6GQP9
Sequence length 1606
Comment (tr|A0A2K6GQP9|A0A2K6GQP9_PROCO) LDL receptor related protein 5 {ECO:0000313|Ensembl:ENSPCOP00000028555} KW=Complete proteome OX=379532 OS=coquereli). GN=LRP5 OC=Lemuriformes; Indriidae; Propithecus.
Sequence
MGWEKCRPSWPALLEQLLRLALLGSSPLLLFANRRDVRLVDAGGVKLESTIVVSGLEDAA
AVDFQFSKGAVYWTDVSEEAIKQTFLNQTGAAVQNVVISGLVSPDGLACDWVGKKLYWTD
SETNRIEVANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDGSTR
KIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLS
GDTLYWTDWQTRSIHACNKRTGEKRKEILSALYSPMDIQVLSQERQPSFHTQCEEDNGGC
SHLCLLSPREPFYACACPTGVQLQDNGKTCKAGAEEVLLLARRTDLRRISLDTPDFTDIV
LQVDDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDGSGAQTLVNTEINDPDGIAVDWV
ARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAIVLHPVMGLMYWTDWGENPKIEC
ANLDGQERHVLVNASLGWPNGLALDLQEGKLYWGDAKTDKIEVINVDGTKRRTLLEDKLP
HIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQLPDLMGLKAVNVAKVVGTNPCA
EGNGGCSHLCFFTPRATRCGCPIGLELLSDMKTCIVPEAFLVFTSRAAIHRISLETNNND
VAIPLTGVKEASALDFDVSNNHIYWTDVSLKTISRAFMNGSSVEHVIEFGLDYPEGMAVD
WMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPRSLALDPTKGYIYWTEWGGKPRI
VRAFMDGTNCMTLVDKVGRANDLTIDYTDQRLYWTDLDTNMIESSNMLGQERVVIADDLP
HPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQGHLDFVMDILVFHSSRQDGLNDC
MHNNGQCGQLCLAIPGGHRCGCASHYTLDPSSRNCSPPTTFLLFSQKCAISRMIPDDQHS
PDLILPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRARDDGTQPFVLASPSQGQNPDRQP
HDLSIDIYSRTLFWTCEATNTINVHRLSGDAMGVVLRGDRDKPRAIVVNAERGYLYFTNM
QDRAAKIERAALDGTEREVLFTTGLIRPVALVVDNTLGKLFWVDADLKRIESCDLSGANR
LTLEDANIVQPVGLTVLGKHLYWIDRQQQMIERVEKTTGDKRTRVQGRVAHLTGIHGVEE
VSLEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQFAC
ATGEIDCIPGAWRCDGFPECDDQSDEEGCPVCSAAQFPCARGQCVDLRLRCDGEADCQDR
SDEADCDAICLPNQFRCASGQCVLIKQQCDSFPDCIDGSDELMCEITKPPSDDTPGHSSA
IGPVIGIILSLFVMGGVYFVCQRVVCQRYAGANGPFPHEYVSGTPHVPLNFITPGGSQHG
PFPGISCGKSMMSSVSLMGGRGGVPLYDRNHVTGASSSSSSSTKATLYPPILNPPPSPAT
DPSLYNMDMFYSSNIPAAARPYRPYIIRGMAPPTTPCSTDVCDSDYSASRWKASKYYLDL
NSDSDPYPPPPTPHSQYLSAEDSCPPSPPPPPRPGWVRELPACPGH
Download sequence
Identical sequences A0A2K6GQP9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]