SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2K6QG63 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6QG63
Domain Number 1 Region: 1037-1168,1231-1297
Classification Level Classification E-value
Superfamily Hemopexin-like domain 7.1e-39
Family Hemopexin-like domain 0.00095
Further Details:      
 
Domain Number 2 Region: 69-108
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000235
Family Somatomedin B domain 0.0011
Further Details:      
 
Domain Number 3 Region: 27-67
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000017
Family Somatomedin B domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K6QG63
Sequence length 1297
Comment (tr|A0A2K6QG63|A0A2K6QG63_RHIRO) Proteoglycan 4 {ECO:0000313|Ensembl:ENSRROP00000027763} KW=Complete proteome OX=61622 OS=roxellana). GN=PRG4 OC=Catarrhini; Cercopithecidae; Colobinae; Rhinopithecus.
Sequence
MAWKTLPIYLLLLLSVFVIQQVSSQDLSSCAGRCGEGYSRDATCNCDYNCQHYMECCPDF
KRVCTVELSCKGRCFESFERGRECDCDAQCKKYDKCCPDYESFCAEVHNPTSPPSSKKAP
PPSGASQTIKSTTKRSPKPPNKKKTKKVVESEEITEEHSVSENQESSSSSSSSSSSSTIR
KIKSSKNSAANRELQKKLKGKDNKKNRTKKKPTPKAPVVDEAGSGLDNGDFKVTTTPATS
TTQHNKVTTSPKITTTKPINPRPSLPPNSDTSKQTSLTANKKTTVETKETTTTNKQTSTD
GKETTSAKETQSVEKTSVKDLAPTSKVPAKTTPKAETTTKSPALTTPKEPTPTTPKEPAS
TTPKEPAPTTTKSAPTTPKEPSPTTTKKPAPTTPKEPGPTTPKEPAPTTTKKPAPTTPKE
PSPTTPKEPGPTTPKEPAPTTPKEPAPTTTKKPAPTTPKEPGPTTPKEPAPTTTKKPAPT
TPKEPSPTTPKSLHPPPLRSLHPLPPREPSPTTPKEPGPTTPKEPAPTTPKEPAPTTTKK
PAPTTTKKPEPTTPKEPALTTPKELTPTTTKKPAPTTPKELTPTTPEELTPTTPEEPAPT
TPEEPAPTTPVEPAPTTPEEPSPTTPKAPAPTTPKEPAPKTAPTTPKGTVPTIPKGTAPT
TPKGTAPTTPKETAPTTPKGTAPTTLKEPAPTTPKKPALKELAPTTTKEPTPTTSDKPAP
TTPKEPAPTTPKKPAPTTPETPPATTLEASTPTTTMEPPTSHKSPDESTPELSAEPTPKV
LENSPKKPAVPTTKTPAVTKPEMTTRAKDKTTERDIRTTTETTTVAPKMTKETATTTEKT
TESKITTTTTQVTSTTTQDTTPFKITTLKTTTLAPKVTTTTKKTITTTEIMNKPEETAKP
KDRATNSKATTAKPQKPTKAPKKPTSTKKPKTTSRGRKPKMTPTPPKMTSTMPELNPTSR
VAEAMLQTTTRPNQTPNSKLVEVNPKNEDAGGAEGETPHMLPRPHVFTPIVIPGMDYSLR
VPNQGIIINPMLSDETDICNGRPVDGLTTLRNGTLVAFRGHYFWMLSPFSPPSPARRITE
VWGIPSPIDTVFTRCNCEGKTFFFKDSQYWRFTNDIKDAGYPKPIFKGFGGLTGQIVAAL
SIAKYKNQPESVYFFKRGGSIQQYIYKQEPVQKCPGRRPALNYPVYGETTQVRRRRFERA
IGPSLTHTIRIHYSPVRLAYQDKGFLHNEVKVSTLWRGLPNVVTSAISLPNIRKPDGYDY
YAFSKDQYYNIDVPSRTARAITTRSGQTLSKVWYNCP
Download sequence
Identical sequences A0A2K6QG63

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]