SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2K6R8P0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6R8P0
Domain Number 1 Region: 52-101
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 2.88e-19
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0000808
Further Details:      
 
Domain Number 2 Region: 3-53
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 7.85e-18
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0000867
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K6R8P0
Sequence length 109
Comment (tr|A0A2K6R8P0|A0A2K6R8P0_RHIRO) Uncharacterized protein {ECO:0000313|Ensembl:ENSRROP00000037398} KW=Complete proteome OX=61622 OS=roxellana). GN= OC=Catarrhini; Cercopithecidae; Colobinae; Rhinopithecus.
Sequence
MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINSALAQRVRNRVNFRG
SLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE
Download sequence
Identical sequences A0A091D1R6 A0A0P6JF23 A0A1A6HFR9 A0A1D5QF26 A0A1S3AEJ7 A0A1S3EM97 A0A1U7QVE1 A0A1U7UHF0 A0A250Y901 A0A286XWL2 A0A287CVB1 A0A2I3M931 A0A2K5KCB4 A0A2K5NCH7 A0A2K5WHM5 A0A2K5ZG76 A0A2K6BLK5 A0A2K6FDV9 A0A2K6MZS8 A0A2K6R8P0 E2R3G8 F2Z4Z2 F6T6Y5 G1QCH5 H2NNE0 O08950 Q3TE88 Q80ZM7
ENSSSCP00000004938 ENSFCAP00000011975 NP_001034608.1.92730 NP_001244983.1.72884 NP_001269012.1.92730 NP_445797.1.100692 NP_445797.1.4139 XP_002718244.1.1745 XP_002825557.1.23681 XP_003121518.1.46622 XP_003121520.1.46622 XP_003363718.1.31192 XP_003463539.1.53824 XP_003987140.1.62641 XP_004274739.1.21590 XP_004391910.1.74151 XP_004406919.1.74151 XP_004421697.1.5094 XP_004602685.1.94378 XP_004662563.1.11716 XP_004687786.1.23501 XP_004758843.2.14098 XP_004758844.1.14098 XP_004855780.1.39548 XP_005075535.1.91757 XP_005316689.1.77405 XP_005347729.1.66349 XP_005347730.1.66349 XP_005347731.1.66349 XP_005559741.1.63531 XP_005559742.1.63531 XP_005559743.1.63531 XP_005559744.1.63531 XP_005638527.1.84170 XP_005861176.1.60319 XP_006104738.1.53796 XP_006141827.1.99106 XP_006182401.1.101512 XP_006211053.1.17985 XP_006243442.1.100692 XP_006511179.1.92730 XP_006740939.1.47382 XP_006758061.1.95426 XP_006831652.1.41390 XP_006979346.1.50099 XP_006979347.1.50099 XP_007128578.1.24612 XP_007128579.1.24612 XP_007166021.1.59432 XP_007166022.1.59432 XP_007166023.1.59432 XP_007458949.1.90284 XP_007533866.1.11023 XP_007608083.1.28591 XP_007608084.1.28591 XP_007647299.1.69978 XP_007956517.1.48129 XP_008014591.1.81039 XP_008014592.1.81039 XP_008014593.1.81039 XP_008014594.1.81039 XP_008069575.1.4292 XP_008137397.1.99482 XP_008579486.1.73410 XP_008579487.1.73410 XP_008704265.1.72690 XP_008773362.1.4139 XP_008835096.1.79516 XP_010372538.1.97406 XP_010372539.1.97406 XP_010639540.1.5607 XP_010967736.1.22495 XP_010967737.1.22495 XP_010978260.1.51371 XP_010978261.1.51371 XP_011752450.1.29376 XP_011752458.1.29376 XP_011752461.1.29376 XP_011752471.1.29376 XP_011795873.1.43180 XP_011795874.1.43180 XP_011795875.1.43180 XP_011838588.1.47321 XP_011838589.1.47321 XP_011838590.1.47321 XP_011948304.1.92194 XP_011948305.1.92194 XP_011948306.1.92194 XP_011948307.1.92194 XP_012390240.1.21590 XP_012513491.1.63892 XP_012513492.1.63892 XP_012513493.1.63892 XP_012638455.1.48125 XP_012638456.1.48125 XP_012865486.1.60039 XP_012972899.1.91757 XP_012972900.1.91757 XP_012972901.1.91757 XP_013000935.1.53824 XP_013000936.1.53824 XP_013201880.1.66349 XP_013213945.1.77405 XP_014412778.1.101512 XP_014706558.1.49734 XP_014706568.1.49734 XP_014926392.1.86478 XP_014926393.1.86478 XP_014997833.1.72884 XP_014997834.1.72884 XP_014997835.1.72884 XP_015100503.1.17985 XP_015336085.1.40921 XP_015336087.1.40921 XP_015394085.1.5354 XP_015853448.1.50099 XP_015853449.1.50099 XP_015982395.1.101085 XP_016834564.1.69978 XP_017203471.1.1745 XP_017751472.1.44346 XP_017751479.1.44346 XP_017751488.1.44346 XP_017751497.1.44346 XP_019279838.1.44245 XP_019297475.1.44245 XP_019297476.1.44245 XP_019513082.1.44202 XP_019587778.1.88060 XP_019687892.1.62641 XP_019802994.1.83887 XP_019802999.1.83887 XP_019803010.1.83887 XP_020037865.1.5219 XP_021062670.1.100879 XP_021549533.1.83697 XP_021551237.1.83697 XP_535502.1.84170 XP_864467.2.84170 ENSCPOP00000000730 ENSSARP00000011038 ENSCAFP00000024508 ENSCPOP00000000730 ENSTBEP00000000902 ENSMMUP00000024248 ENSDORP00000007375 ENSMLUP00000021408 ENSPPYP00000007396 ENSFCAP00000011975 ENSMUSP00000113501 ENSMUSP00000113697 ENSMUSP00000112251 ENSECAP00000009945 ENSCAFP00000024508 ENSTBEP00000000902 ENSRNOP00000014706 ENSPPYP00000007396 ENSSARP00000011038 ENSECAP00000009945 ENSRNOP00000014706 ENSDORP00000007375 ENSMMUP00000024248 ENSSSCP00000004938 10116.ENSRNOP00000014706 10141.ENSCPOP00000000730 9544.ENSMMUP00000024248 9600.ENSPPYP00000007396 9615.ENSCAFP00000024508 9685.ENSFCAP00000011975 9796.ENSECAP00000009945 9823.ENSSSCP00000004938 9823.ENSSSCP00000008212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]