SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2K6SGQ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6SGQ0
Domain Number 1 Region: 8-167
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.41e-43
Family Dual specificity phosphatase-like 0.000000155
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K6SGQ0
Sequence length 173
Comment (tr|A0A2K6SGQ0|A0A2K6SGQ0_SAIBB) Uncharacterized protein {ECO:0000313|Ensembl:ENSSBOP00000006548} KW=Complete proteome OX=39432 OS=Saimiri boliviensis boliviensis (Bolivian squirrel monkey). GN= OC=Platyrrhini; Cebidae; Saimiriinae; Saimiri.
Sequence
MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEK
EGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALI
EGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ
Download sequence
Identical sequences A0A024R8J2 A0A096NFR4 A0A158SIR0 A0A1S3WVA0 A0A2I2V2N6 A0A2I2Z0T4 A0A2K5J8N3 A0A2K5M272 A0A2K5YM68 A0A2K6KTS9 A0A2K6QW99 A0A2K6SGQ0 B9EKL6 D2HTT0 F6Y8J4 G1SQR1 G2HHZ1 H9ENR5 Q63739 Q78EG7 Q93096 Q9TSM6
ENSAMEP00000002560 NP_001233568.1.37143 NP_003454.1.87134 NP_003454.1.92137 NP_035330.1.92730 NP_113767.1.100692 NP_113767.1.4139 XP_002714569.1.1745 XP_002727244.1.4139 XP_003831036.1.60992 XP_003926406.1.74449 XP_003986335.1.62641 XP_004044298.1.27298 XP_004417661.1.74151 XP_004605935.1.94378 XP_004775707.1.14098 XP_004775708.1.14098 XP_005552682.1.63531 XP_005552683.1.63531 XP_005627571.1.84170 XP_006244733.1.100692 XP_006495861.1.92730 XP_006495862.1.92730 XP_006747816.1.47382 XP_006747817.1.47382 XP_006747818.1.47382 XP_007074475.1.5354 XP_007538249.1.11023 XP_008011805.1.81039 XP_008011806.1.81039 XP_008011807.1.81039 XP_008011808.1.81039 XP_008261300.1.1745 XP_008580415.1.73410 XP_008683039.1.72690 XP_008765001.1.100692 XP_010362578.1.97406 XP_011534413.1.92137 XP_011534414.1.92137 XP_011801022.1.43180 XP_011801023.1.43180 XP_011848454.1.47321 XP_011923798.1.92194 XP_011923808.1.92194 XP_011923815.1.92194 XP_012424049.1.74151 XP_012424050.1.74151 XP_012424051.1.74151 XP_012629318.1.48125 XP_012629319.1.48125 XP_013973573.1.84170 XP_014942887.1.86478 XP_014992117.1.72884 XP_014992118.1.72884 XP_015841423.1.50099 XP_016050303.1.11023 XP_016050304.1.11023 XP_016866759.1.92137 XP_016866760.1.92137 XP_017723045.1.44346 XP_017723053.1.44346 XP_017723064.1.44346 XP_017723074.1.44346 XP_018885137.1.27298 XP_018885138.1.27298 XP_018885139.1.27298 XP_019273186.1.44245 XP_019662227.1.58354 XP_020142720.1.48125 XP_021547628.1.83697 XP_021547629.1.83697 XP_021547630.1.83697 XP_021547631.1.83697 XP_538984.1.84170 ENSAMEP00000002560 ENSMUSP00000027232 ENSCAFP00000003628 10090.ENSMUSP00000027232 10116.ENSRNOP00000016237 9598.ENSPTRP00000031296 9606.ENSP00000359685 9615.ENSCAFP00000003626 9986.ENSOCUP00000005458 ENSEEUP00000005887 ENSCAFP00000003628 ENSP00000359685 ENSEEUP00000005887 ENSMUSP00000027232 ENSP00000359678 ENSRNOP00000016237 5mmz_B ENSPANP00000011766 NYSGXRC-8648a NYSGXRC-T748 ENSMUSP00000027232 ENSMUSP00000110861 ENSPTRP00000031296 ENSRNOP00000016237 ENSRNOP00000067713 ENSOCUP00000005458 ENSP00000359685 ENSPTRP00000031296 ENSOCUP00000005458 gi|4506283|ref|NP_003454.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]