SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0KGC8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0KGC8
Domain Number 1 Region: 551-1038
Classification Level Classification E-value
Superfamily ALDH-like 4.06e-130
Family ALDH-like 0.000000415
Further Details:      
 
Domain Number 2 Region: 190-532
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 3.77e-111
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000000293
Further Details:      
 
Domain Number 3 Region: 18-189
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 9.29e-63
Family N-terminal domain of bifunctional PutA protein 0.0000194
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0KGC8
Sequence length 1054
Comment (tr|A0KGC8|A0KGC8_AERHH) L-glutamate gamma-semialdehyde dehydrogenase {ECO:0000256|PIRNR:PIRNR000197} KW=Complete proteome; Reference proteome OX=380703 OS=JCM 1027 / KCTC 2358 / NCIMB 9240). GN=AHA_0776 OC=Aeromonadaceae; Aeromonas.
Sequence
MFKATQVLAADYVPSDLAALREAITQNYVVDENAYLAELSAMLPGDGASLERVTQRARTL
VTKVRKESGSGDGIDAFLQEYSLDTQEGIILMCLAEALLRIPDAETADALIKDKLSGANW
SSHFRKSDSTLVNASTWGLMLTGKIIKLDKKLDGNPANLLGRMVNKLGEPVVRSAMYAAM
KIMGKQFVLGRDMKEALKASRKSREKGYTHTYDMLGESALTLADADKYFGDYQRAIEAVG
NERISDGGPAPSISIKLSALHPRYDVANRERVLGEMCERLVGLVRLARDKDVAISIDAEE
MDRLELSLDLFEQLYRSDANRGWGKLGMVVQAYSKRALPVLCWLTALAREQGDLIPVRLV
KGAYWDSELKYAQQAGLPGYPLFTRKAGTDISYLACARYLLSEPTRGFISPQFATHNANT
VVSILEMAGDRQFEFQRLHGMGEELHNAVLSEYPGLHCRIYAPVGAHKDLLPYLVRRLLE
NGANTSFVHKLVDPNTPVDSLAEHPLRTLKRYSSLANDRIPQPVNLFSDRKNSSGVNMNI
LSIQRPFFAKLKEVESKQWLAGPIVDGETLKRNEARVVLSPQDVSLTVGKIHWADEQAVE
QALASAHAAFPRWRETPVSERAAALEKLADLLEANREQFISLCTREAGKLLQDGIDEVRE
AVDFCRYYAVQARGLMGQATLLPGYTGEMNELFLQGRGVFVCISPWNFPLAIFLGQVAAA
LATGNTVIAKPAEQTGLIAHLAVTLAHQAGIPGDVLQLLPGDGATVGAKLTADARIGGVC
FTGSTETAKLINMTLAQRDGAILPLIAETGGQNAMIVDSTALPEQVVRDVVSAAFQSAGQ
RCSALRVLYLQEEIAPRVLEILTGALQELKVGNPAEHNTDVGPVIDAEAKAGLDAHLVHM
IPRARLIAQAPMPAVTLGGHFVQPTALEIGSIRELTREQFGPILHVVRYAARDLDKVISD
INGTGYGLTLGIHSRNESHAEELASRINVGNVYINRNQIGAMVGVQPFGGQGLSGTGPKA
GGPHYLSRFITEKTRTINTTAVGGNASLLAMGDA
Download sequence
Identical sequences A0KGC8
gi|117620021|ref|YP_855318.1| WP_011704727.1.12787 YP_855318.1.44769 380703.AHA_0776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]