SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0L9Q1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0L9Q1
Domain Number 1 Region: 447-560
Classification Level Classification E-value
Superfamily SpoIIaa-like 3.34e-16
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0L9Q1
Sequence length 608
Comment (tr|A0L9Q1|A0L9Q1_MAGMM) Sulfate transporter {ECO:0000313|EMBL:ABK44694.1} KW=Complete proteome; Reference proteome OX=156889 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1). GN=Mmc1_2193 OC=Magnetococcaceae; Magnetococcus.
Sequence
MQSSRASFLTLLFPFLSWMKEMNRSTINADLQAGLIGAIVTLPQAVAFAAIAGLPPQYGL
YTCMVPAIIAALFGSSKHLVSGPTTAASIVIFAGLSSFATPESEQYVALAITLTFMVGII
QLAMGFARLGALVNFISHSVVVGFTAGAALLIASHQLKHFLGIHLEHGGHFFDLLKEIFS
RLDETNLYVLVVGLSTLVVSILTKKFFPRVPYMIVAILFGSVLAYFFNSNIENAKIILAG
DVPGNFPIFAMPQLSLDTLKQLAPLALATTLFALTEAVSIGRSLAIKSGQHVHSNQEFIG
QGLSNLVGSFFSAYVATGSFNRSGLNYQIGAKTQLSAIVGGLVLLATIPLTAPLASFMPK
AVMAAILFLVAWGLIDFHHIRNIFQTSHSDSVVLVTTFGGTLFLELEFAILLGVLLSLVI
FLFKTSQPRVLERVPDPRLPKRRFNTDPNLPTCPQMKIIRIDGELFFGAVSHIQETFIRL
RTESPEQKHLMLVASGINFLDVAGAELLAQEAHTRRKMGGGLYLLRIKPGVCEPISKGPY
LDEISAMNIFESKGEAIHEVYQLLDKDICSQCSSHIFLECGGKPSKHSTDSLNSLDDLYR
EKPVTNPQ
Download sequence
Identical sequences A0L9Q1
WP_011713816.1.83473 156889.Mmc1_2193 gi|117925483|ref|YP_866100.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]