SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0LCA0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0LCA0
Domain Number 1 Region: 45-104
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000116
Family Anti-sigma factor antagonist SpoIIaa 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0LCA0
Sequence length 108
Comment (tr|A0LCA0|A0LCA0_MAGMM) Anti-sigma-factor antagonist {ECO:0000313|EMBL:ABK45593.1} KW=Complete proteome; Reference proteome OX=156889 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1). GN=Mmc1_3103 OC=Magnetococcaceae; Magnetococcus.
Sequence
METLRSCQYFNIYLSEHDVEIIPHQAPSFATSSYYLILAQQVPQDLHVIFNCSTFDHIDS
GGLGTLILFHNNLAHLNQPVTLREIHPKVMKKLKTAHLQQLFHLEELP
Download sequence
Identical sequences A0LCA0
156889.Mmc1_3103 gi|117926382|ref|YP_866999.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]