SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0LGP3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0LGP3
Domain Number 1 Region: 353-485
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 9e-27
Family Potassium channel NAD-binding domain 0.0091
Further Details:      
 
Domain Number 2 Region: 8-153
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.72e-21
Family Voltage-gated potassium channels 0.0022
Further Details:      
 
Domain Number 3 Region: 129-262
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.07e-18
Family Potassium channel NAD-binding domain 0.013
Further Details:      
 
Domain Number 4 Region: 487-566
Classification Level Classification E-value
Superfamily TrkA C-terminal domain-like 0.0000000000157
Family TrkA C-terminal domain-like 0.0042
Further Details:      
 
Domain Number 5 Region: 273-346
Classification Level Classification E-value
Superfamily TrkA C-terminal domain-like 0.0000000000837
Family TrkA C-terminal domain-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0LGP3
Sequence length 567
Comment (tr|A0LGP3|A0LGP3_SYNFM) TrkA-N domain protein {ECO:0000313|EMBL:ABK16595.1} KW=Complete proteome; Reference proteome OX=335543 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB). GN=Sfum_0899 OC=Syntrophobacteraceae; Syntrophobacter.
Sequence
MKLLTTQLSYLLSQQQTRRNLKALLKFVLFLTAVVLLYAVVFHWIMVTIEKRDHSWLTGI
YWTLTVMSTLGFGDITFHSDVGRAFSIVVLLSGIVLLLIVLPFAFIRFFYAPWLEAQMRL
RAPREVPHDMSGHVIICRYETVAQGLIRKLKAFRIPYYVLEPDATLAANLYEEGVSVVTG
EVDNSTTYAALRASEARMVLANADDATNTNITLTVRETAAKAPVVAIVESIDSVDILELA
GATHVLPLKQRLGEHLAYRVTAERTNVHVIGTFRDLRIAEFPVQNTPLAGCMIRETRLRQ
RTGVNVVGVWERGHLLPAKPDTVLAESSVPVILGTAGQIADMESFLVTENVNRNPILVIG
CGNVGYAVTCALKNKSLAFHVVERDKAVEERSSSIAGELFIGDAADRSVLMRAGLAEAPS
AVITTNDDAMNIYLTVYCRRLNPRLRIVSRITHERNLEAIHRAGADFVLSYASLGAESIF
SILQERELIMLGEGIDLFVAKVPESLAGKSLGKTNIGAETGLTVIAIQKGGDVVTNPPAS
AVIDSDSELLMIGSSEQRDEFAARFGV
Download sequence
Identical sequences A0LGP3
335543.Sfum_0899 gi|116748343|ref|YP_845030.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]