SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0R9S7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0R9S7
Domain Number 1 Region: 4-273
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.74e-71
Family Phosphate binding protein-like 0.0000818
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0R9S7
Sequence length 276
Comment (tr|A0R9S7|A0R9S7_BACAH) Amino acid ABC transporter substrate-binding protein, PAAT family {ECO:0000313|EMBL:ABK83970.1} KW=Complete proteome OX=412694 OS=Bacillus thuringiensis (strain Al Hakam). GN=BALH_0581 OC=Bacillus cereus group.
Sequence
MLKMKKLFTLIVFSCLFVLVVAGCGSKKDEAKETNTKQGGAVEQIKKRGKLVVGVKNDTN
LFGLKNPSTGQVEGFDVDIAKALAKKILGDEKKLELKEVTSKTRIPLLKNGDIDAIIATM
TITEERKKEVDFSDVYFKAGQSLLVKKGSDIKSIDDVKKGVKVLAVKGSTSTNNIRQKSP
EATVLEFENYSEAFTALKAGKGDVLTTDNAILYGMAKQDSNYEVVGKIFTDEPYGIAVQK
GADDLTKEINSLIKDMKANGEYDKLYEKWIGQKPEK
Download sequence
Identical sequences A0A1J9WZY8 A0R9S7
gi|376264605|ref|YP_005117317.1| gi|118476326|ref|YP_893477.1| 412694.BALH_0581 WP_000916476.1.33828 WP_000916476.1.3699 WP_000916476.1.46476 WP_000916476.1.59978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]