SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0REZ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0REZ8
Domain Number 1 Region: 26-284
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.91e-81
Family Phosphate binding protein-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0REZ8
Sequence length 285
Comment (tr|A0REZ8|A0REZ8_BACAH) Glycine betaine-binding protein {ECO:0000313|EMBL:ABK85791.1} KW=Complete proteome OX=412694 OS=Bacillus thuringiensis (strain Al Hakam). GN=BALH_2504 OC=Bacillus cereus group.
Sequence
MRKKIWFICLALFITMIFTSCNATNANSKGKIKLGVTSWKENIATANMWKVLLEQKGYKV
ELMYLEKAAIWTGVARGDVDANLEVWLPVTDKPLNNRYKDDIVLKSKWYEGTGLGLVVPS
YMKNISSIEDLNTHKDELDNKIIGIEPGSSLMNLTNKAMKKYDIKLKLVQSSEAALMSEL
KKAYTKKKPIAVTLWNPHWGFSEFDLKYLKDPKKVYGEKDDIYYSVRKGFEKDHPDIIKY
FDKWKMNDEQLGTLMVELNKTKDPEEAARKWIKKNQALVDEWIKD
Download sequence
Identical sequences A0REZ8 C2NIP2
gi|376266653|ref|YP_005119365.1| 412694.BALH_2504 gi|118478147|ref|YP_895298.1| WP_001227638.1.24676 WP_001227638.1.33828 WP_001227638.1.3699 WP_001227638.1.46476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]