SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0RPA1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0RPA1
Domain Number 1 Region: 8-204
Classification Level Classification E-value
Superfamily PLP-binding barrel 6.8e-58
Family "Hypothetical" protein ybl036c 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0RPA1
Sequence length 205
Comment (tr|A0RPA1|A0RPA1_CAMFF) Pyridoxal phosphate homeostasis protein {ECO:0000256|HAMAP-Rule:MF_02087} KW=Complete proteome; Reference proteome OX=360106 OS=Campylobacter fetus subsp. fetus (strain 82-40). GN=CFF8240_0859 OC=Campylobacteraceae; Campylobacter.
Sequence
MRLDEILSKIGSTKLIAVSKNVTENEVLELYNQGQIDFGENRVQELKRKKEILKDLNLNW
HFIGRLQANKINHLLALHPNLWQSCESFSMAEAVDKRLDYILPTLLQINSAHEESKQGVD
PNAACEEFLRIKQSCKNLNLIGVMSIGAHSDDIKEIQKSFESTYKIYENLQEHGAKICSM
GMSSDYELAIKCGSNMIRLGTILYK
Download sequence
Identical sequences A0A0E1GLQ4 A0RPA1 W0DAC9
360106.CFF8240_0859 gi|118474783|ref|YP_892034.1| WP_002849357.1.1289 WP_002849357.1.1469 WP_002849357.1.16919 WP_002849357.1.17016 WP_002849357.1.36062 WP_002849357.1.38168 WP_002849357.1.39057 WP_002849357.1.41035 WP_002849357.1.42553 WP_002849357.1.42882 WP_002849357.1.44411 WP_002849357.1.46075 WP_002849357.1.46714 WP_002849357.1.48558 WP_002849357.1.51765 WP_002849357.1.5603 WP_002849357.1.59303 WP_002849357.1.60351 WP_002849357.1.62614 WP_002849357.1.63275 WP_002849357.1.68475 WP_002849357.1.71429 WP_002849357.1.74407 WP_002849357.1.77394 WP_002849357.1.81562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]